(data stored in ACNUC7421 zone)

EMBL: CP002160.PE45

CP002160.PE45        Location/Qualifiers
FT   CDS_pept        complement(85197..86177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0047"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: cbe:Cbei_4326
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49836"
FT                   /db_xref="GOA:D9SMQ1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADL49836.1"
FT                   /translation="MNTIINKIIHNLINNYGFVVEKYGDNVNNSDKLVLLKYLPDGIYS
FT                   VIFSNAYDEASNAMFLRKYLLVKGQKFIINNIIFLESTHNYIPSSPFYNYMLIDSKAKI
FT                   ILYSNIAIDSLRSSVENSLFSRKHIKNNLFSSNQITSIIIFLNIVIFLYSSYINGDIFD
FT                   INTLILVQLGAKVNSYIINGEFYRLLTCTFLHSGLMHIAFNMYALNNIGRLIERVYGWK
FT                   KFILIYIFAGLSGSLASFLFSPYVSVGASGAIFGLFGAALIMGLKLKKYINSNFLGSLA
FT                   SVIVVNVIFGFSSTGIDNYGHIGGLLGGLLMGALLFNKKNALAKL"
     atgaatacta taataaataa aattatccac aatttgatta ataattatgg ttttgttgtt        60
     gaaaagtatg gtgacaatgt taacaattct gacaaactag tattactaaa atatctacct       120
     gatggaattt attcagttat tttttcaaat gcctatgatg aggcatcaaa tgcaatgttt       180
     cttagaaaat atctattggt gaaaggccag aaatttatca ttaataatat aatttttcta       240
     gaaagtactc ataattatat cccatcgtct cctttttaca attatatgct tatagattct       300
     aaagctaaaa ttattttata ttcaaacatt gcaatagact ctcttaggtc ctctgtggaa       360
     aactctttat tctcaagaaa acatataaaa aataaccttt tttctagcaa tcaaataact       420
     tcaataatta tctttttaaa tatagtaatt ttcctttatt cttcatatat aaatggagat       480
     atatttgaca tcaacacctt gatattagtt caattgggtg caaaagtgaa tagttatatt       540
     attaatggcg aattttacag acttcttacc tgtacattcc tccatagtgg attaatgcat       600
     attgctttta atatgtatgc actaaataat ataggtcgct taatagagcg agtttatggt       660
     tggaaaaaat tcattttaat atatatattt gctggactct caggctccct tgctagcttc       720
     ttattttcac cttatgtttc tgttggtgca tctggcgcta tctttggtct ctttggagct       780
     gcactaatta tgggactaaa gttaaagaaa tatataaaca gcaactttct tggaagctta       840
     gcttcagtaa ttgtagtaaa tgttatattt ggcttttcaa gtacaggcat agataactat       900
     ggtcatattg gaggtctgct tggtggatta ttaatgggtg ctttgctatt taataagaaa       960
     aatgcccttg caaaacttta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page