(data stored in ACNUC7421 zone)

EMBL: CP002160.PE451

CP002160.PE451       Location/Qualifiers
FT   CDS_pept        579915..582434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0466"
FT                   /product="Dockerin type 1"
FT                   /note="PFAM: Dockerin type 1; FG-GAP repeat protein; KEGG:
FT                   cth:Cthe_0246 carbohydrate-binding family 6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50242"
FT                   /db_xref="GOA:D9SQH5"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH5"
FT                   /inference="protein motif:PFAM:PF00404"
FT                   /protein_id="ADL50242.1"
FT                   /translation="MLKKALLSVFMGAAVLLGSIAPQTITTTAATARQMENLDRGVVAV
FT                   KVSNGVFVSWRVLGTEATNVSYNLYRDSVKVANITGASNYIDASGTTTSKYSVSAVVNG
FT                   VEQSKSTAVSVLGNNYMQLPLQIPAGGKTPDGVAYTYNANDCSVGDLDGDGQYEIVLKW
FT                   DPSNSKDNSQKGYTGNVFLDAYEMNGTRLWRIDLGKNIRAGAHYTQFMVYDLNGDGKAE
FT                   VACKTSDGTKDGVGTVIGNASADYRNSSGYILSGPEYLTIFQGSNGKALNTINYEPGRG
FT                   NVSSWGDSYGNRVDRFLGCIAYLDGVHPSLVMCRGYYTRAVLVAYDWNGSTLTKRWTFD
FT                   SNTSGNSGYAGQGNHNLSVADVDSDGKDEIIYGGCTIDDSGKGLYTTGLRHGDALHVSD
FT                   LDPSRPGLEVWSCHEDTSGNGGIGGSFRDAKTGQVLWSFKAANDTGRACSADVTAAYPG
FT                   EEVWASGSSLYSSKGENIGNRPGPVNFAIWWDGDELRELLDDTTISKYGGGNLLSVSDC
FT                   DSNNTTKATPCLQADILGDWREEVIWRTTDNKYLRIYTTTATTSRRIYTLMHDPVYRMG
FT                   VAWQNVAYNQPPHTGFFLGSGMSTPPTPAIYLAGAVAPVPIPEPIPDGQHIKTLTVKDT
FT                   DNAADWSIQSNLQVGDIVYGDRTNKFSVIPSKLLGAEWIRTACDSKLYTSDLAAFTTKS
FT                   DVSVYVGLDARITSIPSWISSWINTGEVLTNDSAVTFNLYKKDFSANSNVVLGTNGASS
FT                   SSVNYTVIVVPNTAPTLIYGDVNGDGVANAIDYAVMKKYLLGTITSMPSANWQKVGDLN
FT                   SDGVINAIDYAYFKKYLLGSITKLPVS"
     atgttaaaaa aagcgctttt aagtgttttc atgggtgcag cagtgttact aggctctatt        60
     gccccgcaaa caatcacaac aacggcagca acagcacgac aaatggaaaa tttagaccgt       120
     ggcgtagttg ctgtaaaagt aagtaacgga gtttttgtaa gctggcgtgt gctaggtact       180
     gaagcaacaa atgtatctta taacctttat cgcgattcag taaaggtagc taatattacg       240
     ggggctagca actatattga tgcgtcaggt acaacaactt caaaatactc ggtaagtgcc       300
     gttgttaatg gtgtagaaca atcaaaatca actgctgtaa gtgttttagg aaataactac       360
     atgcaacttc cactacaaat cccagcaggt ggaaaaactc ctgatggagt ggcttatacg       420
     tacaatgcaa atgattgtag cgtaggtgat ttagatggtg atggacaata tgaaatcgtt       480
     ttgaaatggg atccatcaaa ctcaaaagat aactctcaaa aaggttatac aggtaatgta       540
     ttccttgacg cttatgaaat gaatggaact cgcctatgga gaatagacct aggtaaaaat       600
     atccgtgccg gtgcacatta tactcaattc atggtatatg acttaaatgg tgatggaaaa       660
     gctgaagtag cttgtaaaac atctgatggt acaaaggatg gagttggaac tgtcattgga       720
     aatgccagtg cagattatcg taattcctca ggttacatat tatctggacc agaatactta       780
     actattttcc aaggaagtaa tggtaaagct cttaatacaa taaattatga gcctggcaga       840
     ggaaacgttt ctagttgggg agattcttat ggtaaccgtg tagatcgttt cttaggctgt       900
     atcgcttatc tagatggtgt acatccaagc cttgttatgt gtcgtggata ttatacacgt       960
     gcagtacttg ttgcttatga ctggaatggt tcaactctta caaaacgttg gactttcgat      1020
     agtaatacta gtggaaattc aggttatgct ggacaaggta accataacct tagtgtagca      1080
     gacgttgata gtgatggaaa agacgaaata atctatggtg gttgtactat agatgacagc      1140
     ggtaaaggtt tatatactac tggtttaaga catggtgacg cattacatgt aagtgattta      1200
     gatccaagtc gtcctggtct tgaagtttgg agttgtcacg aagatactag tggtaatggt      1260
     ggtattggag gatctttccg tgatgcaaaa acaggacaag tgttatggag ttttaaagca      1320
     gctaatgata ctggaagagc ttgctcagct gacgttacag cagcttatcc tggagaagaa      1380
     gtatgggctt ctggttcatc actttatagt agcaaaggag aaaatatagg taataggcct      1440
     ggtcctgtta acttcgctat ttggtgggat ggagacgaac ttcgtgaact tctagatgat      1500
     actactattt ctaagtatgg tggcggaaac ttactttctg tcagcgactg tgattcaaat      1560
     aatactacaa aagctactcc atgtttacaa gcagatatcc ttggtgattg gcgtgaagaa      1620
     gtaatctgga gaacaactga caataaatat ctacgtattt atacaactac agctactaca      1680
     agccgtcgta tttacacttt aatgcatgac cctgtatatc gtatgggagt tgcttggcaa      1740
     aatgttgctt ataatcaacc acctcacact ggtttcttcc ttggaagtgg tatgtcaaca      1800
     cctcctacac cagctatata tttagcaggt gctgtggcac cagtaccaat accagagcca      1860
     attcccgatg gacaacatat aaaaacttta acagtaaagg atacagataa tgctgctgat      1920
     tggtcaattc aatcaaattt acaggttgga gacattgtct atggggatcg tacaaataaa      1980
     tttagtgtaa ttccaagcaa gcttttagga gcagaatgga taagaacagc ttgtgattct      2040
     aaattataca catcagattt agcagcattt acaacgaaat cagatgtttc agtttatgta      2100
     gggttagatg caagaattac aagtatccca tcatggataa gtagttggat aaatactggt      2160
     gaagtgttaa caaatgattc agctgttact tttaatcttt ataaaaagga cttctccgca      2220
     aattccaatg tagttcttgg aaccaatgga gcttcaagta gttcagtgaa ttacactgtc      2280
     atcgttgttc caaatactgc tccaaccctt atatatggag atgtaaatgg ggatggagtt      2340
     gcaaatgcca tagattatgc tgttatgaaa aaatatcttt taggtacaat cacctcgatg      2400
     ccttcagcaa attggcagaa ggttggggat ttaaattcag atggtgtaat taacgctatt      2460
     gattatgcat actttaagaa atacttatta ggttcaataa ctaaacttcc agtttcttaa      2520
//

If you have problems or comments...

PBIL Back to PBIL home page