(data stored in ACNUC7421 zone)

EMBL: CP002160.PE453

CP002160.PE453       Location/Qualifiers
FT   CDS_pept        583032..583499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_0703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50244"
FT                   /db_xref="GOA:D9SQH7"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH7"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0703"
FT                   /protein_id="ADL50244.1"
FT                   /translation="MILKMLMSQTGTDKDYKEVLKKRIGLCYVVVVLGLSTLGLALFFS
FT                   SHLSSFLSGVYTGIGAGLIGAGIALIIKMKRVLKDEKKIKQKRLSEQDERNIMINQKAV
FT                   QASTIVILVLAYLGLMVSGIFNLIVFWTLWVVVAVFMVVFVIFSFYYNKKY"
     atgattttga aaatgttaat gtctcaaaca ggtacagata aggattataa agaagtttta        60
     aagaaaagaa ttggattatg ctatgttgta gtagttcttg gtttaagtac attaggctta       120
     gctctctttt tttctagcca cttatcaagc tttctaagtg gtgtttatac aggaatagga       180
     gctgggttaa ttggagcagg tatagcatta ataatcaaaa tgaaaagagt tttaaaagat       240
     gaaaagaaaa taaaacaaaa aagactttca gaacaagatg aaagaaacat aatgatcaat       300
     cagaaagcag ttcaagcgtc tacaattgta atattagtac ttgcctattt agggcttatg       360
     gtatctggaa ttttcaactt aatcgtgttt tggactctat gggttgttgt ggcagtgttt       420
     atggtagtct tcgttatatt cagtttctac tataataaaa aatattaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page