(data stored in ACNUC7421 zone)

EMBL: CP002160.PE454

CP002160.PE454       Location/Qualifiers
FT   CDS_pept        583651..583851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_0825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50245"
FT                   /db_xref="GOA:D9SQH8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH8"
FT                   /inference="similar to AA sequence:KEGG:CLK_0825"
FT                   /protein_id="ADL50245.1"
FT                   /translation="MKKRKLVKGNIILSMGLLTLSATLILEQTLNLPHFVSGVGLGIAI
FT                   GLEIFGLYLMGKNKKQATGEK"
     atgaaaaaaa gaaaattagt aaagggaaat ataattttat caatgggact tttaactcta        60
     tccgcaacat taatattaga gcaaacgtta aacctacctc attttgtttc aggagtaggt       120
     ttgggaatcg ctattggttt agaaatattt gggctttatc ttatgggaaa aaataaaaaa       180
     caagctacag gggaaaaata a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page