(data stored in ACNUC7421 zone)

EMBL: CP002160.PE455

CP002160.PE455       Location/Qualifiers
FT   CDS_pept        complement(584103..584903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50246"
FT                   /db_xref="GOA:D9SQH9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQH9"
FT                   /inference="similar to AA sequence:KEGG:Cphy_1635"
FT                   /protein_id="ADL50246.1"
FT                   /translation="MISFPLLKREIKANYKLLLIFMGVLTMYVSMIVYMFDPKIGETLQ
FT                   AFEESMPGVMAAFGMSNMGTTLTEFLTSYLFGFLLLIFPMIFEIILSNKLIARYVDRGS
FT                   MAYILASPNSRKKIAFTQGLFLIKSIAILLTYTMIVGIVTSEIAFPGSLDIPKYILLHV
FT                   GLLCLHIAISGLGFLTSCLFNDTKFSYAISAGVPIGFYLIQMLANMGGHLENLKYITIF
FT                   TLFDTDKLIAGDANGIFMILILLVSGLILYAAGIWQFNKRDLPL"
     atgattagtt ttccattatt gaaaagagaa attaaagcta attataaatt acttcttatt        60
     tttatgggtg tacttacaat gtacgtttca atgattgtat atatgtttga ccctaaaata       120
     ggagaaactc tacaggcatt tgaagaatca atgcctgggg ttatggcagc tttcggaatg       180
     agcaatatgg gaacgacttt aacagaattt ctaacttcat acttgttcgg atttttactt       240
     cttatatttc caatgatatt cgaaataatt ttatctaata aattaattgc tcgctatgtg       300
     gatagaggat caatggcata tatccttgcc tcacctaatt caagaaaaaa gattgccttt       360
     actcaaggtt tatttttaat aaaaagcatt gccatcttgc taacttatac aatgatagtt       420
     ggaatagtaa catcggaaat cgcatttcca ggttctctag atattccaaa atatattcta       480
     ctacatgtag gacttttatg cttgcatata gcaatcagtg gcctaggctt ccttacttct       540
     tgtttattta atgatacaaa attctcctat gctatcagtg ctggagtccc aattggtttc       600
     taccttattc aaatgttagc aaacatgggt ggtcacttag aaaatttaaa atatataaca       660
     atttttactt tgtttgatac agataagctt atagcaggtg atgccaatgg tatatttatg       720
     atattaattt tattagtatc aggactcatt ctttatgctg ctggaatatg gcaatttaat       780
     aaaagagatt taccattgta g                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page