(data stored in ACNUC7421 zone)

EMBL: CP002160.PE456

CP002160.PE456       Location/Qualifiers
FT   CDS_pept        complement(584896..585795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0471"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cpy:Cphy_1634 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50247"
FT                   /db_xref="GOA:D9SQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQI0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50247.1"
FT                   /translation="MKIIELNHITKDYGDGKGVFDISFSVEKGEVLGFLGPNGAGKTTT
FT                   IRHLMGFSHPDKGSCSIDGLNCTTESAEIQKKLGYLPGEIAFMDDITGMEFIKFVGSMK
FT                   GMKDYSRAEALIKKFELNPKGRIKKMSKGMKQKIGIVCAFMAEPEILILDEPTSGLDPL
FT                   MQNKFVELILEEKAKGTTILMSSHMFEEIERTCDRAAIIKSGKIVAVENISTLKESRCK
FT                   TYMITLETPQMAETFSEEPSISDKVTKVENNLVTLSIQGDIMPFIETMTRYKVVSLNIA
FT                   TLSLEELFMHYYGGAKND"
     atgaaaatca tcgaacttaa ccacataaca aaagattacg gagatggtaa aggtgttttc        60
     gatatatcct tttctgttga aaaaggcgaa gtattaggct ttctaggacc aaacggagca       120
     ggtaaaacta caaccatacg tcatcttatg ggctttagtc acccagacaa aggaagttgt       180
     agcatcgatg gtctaaactg tactactgaa tcagcagaaa ttcaaaaaaa acttggttat       240
     cttcctggcg aaatcgcttt tatggatgat attacaggaa tggaattcat caaatttgta       300
     ggctctatga aaggtatgaa agactactca agagctgaag cccttattaa aaaatttgaa       360
     ctaaacccta agggaagaat caagaaaatg tccaaaggta tgaaacaaaa aataggcata       420
     gtatgtgcct ttatggcaga accagaaata ttaattttag atgaaccaac tagtggttta       480
     gatcctctta tgcaaaataa atttgtagag cttattttag aggaaaaagc aaagggtaca       540
     actatactta tgtcttctca catgtttgag gaaatagaaa gaacttgtga tagagctgcc       600
     atcattaaaa gtggaaagat tgttgctgtt gaaaatatat ctacgttaaa agaatctcgt       660
     tgtaaaacct atatgataac tttggaaact ccacaaatgg cagagacctt ttcagaagaa       720
     ccctcgattt ctgataaggt aacaaaagtt gaaaataacc ttgtaacact atcaatccaa       780
     ggcgatataa tgccttttat tgagacaatg acacgctata aggtagttag ccttaatatc       840
     gcaacactaa gtttagaaga attatttatg cattattacg gaggtgctaa aaatgattag       900
//

If you have problems or comments...

PBIL Back to PBIL home page