(data stored in ACNUC7421 zone)

EMBL: CP002160.PE466

CP002160.PE466       Location/Qualifiers
FT   CDS_pept        598455..599900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0481"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cbe:Cbei_2435 PAS/PAC sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50257"
FT                   /db_xref="GOA:D9SQW9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQW9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADL50257.1"
FT                   /translation="MLRKIKKFIFIIENSGLTKEEIIEFEKKRINLNVSRTNKPIVAVF
FT                   IFSSIQIVIDIFDIVLGKNDIKQLSNIFLLHVFAVIFSLLWVLFYKFKDKYNIFRMLEK
FT                   TYYLFNVIFVVICANNSVNNLAVSGQISPYIISCFVFAWVLLIPPKISVTTLIAGAIGF
FT                   LIRVRFEGLPHNAWMGVLISVVICTIFSVIMSINSYSNFLGQYINNKMLVEINRKLEAL
FT                   EKDRLEFFANISHELRTPINIIYTANQMINVTNKNSSCPIKALSKYSNMIQQNCNRLIR
FT                   LVENVIDITKIDSLSFEVRLINADIINILEETYFSIRDYVEKKGLKIYFNTNIDKKIIA
FT                   CDPYNIERIILNILSNSIKFTKPGGEIKISITSDENFVYISVSDTGIGIPENMIDRIFE
FT                   RFVQVDKSTMRQNEGSGIGLSLVKGLVELHNGTISVNSVLGKGSEFIIKLPNKITEKEN
FT                   NISQLGLISDSTEKVSIQFSDIY"
     atgcttagaa aaataaaaaa atttatattt attatagaaa atagtggatt aaccaaggaa        60
     gaaattattg aatttgaaaa aaagaggata aacttaaatg tttctagaac taacaaacct       120
     attgtagctg tatttatatt ttcttctatt caaattgtaa tcgatatatt tgatatagta       180
     ctaggaaaaa atgatattaa acaattatcg aacatatttt tacttcatgt atttgccgta       240
     attttttctt tgctatgggt attattttat aaatttaaag acaaatataa tatattcaga       300
     atgttggaaa agacttatta cttatttaat gttatttttg ttgtaatatg tgcaaataat       360
     tcagtaaata atttagcagt atcggggcaa atttctccat atataatttc ttgttttgtt       420
     tttgcttggg tattattgat tccacccaaa ataagtgtta ctactttaat cgctggagca       480
     ataggttttt taattagagt aagatttgaa gggctaccac ataatgcgtg gatgggtgtg       540
     cttatttcag tagttatatg cactattttc tctgttatca tgtcaataaa tagttattca       600
     aattttttag gacaatatat aaataataaa atgttagtgg agataaatag aaagttagaa       660
     gctttagaaa aggatagatt agaattcttt gctaatattt ctcatgaact tagaacacct       720
     attaacatca tatatacagc aaaccaaatg ataaatgtaa caaataaaaa cagtagttgc       780
     ccaattaaag ctttatcaaa gtattcaaat atgatacagc aaaattgtaa tagacttatt       840
     agattagttg agaatgtcat agatattact aagatagatt cattaagttt tgaggtacga       900
     cttataaatg ccgacatcat aaatatatta gaagaaacat atttttctat aagagattat       960
     gtagagaaaa aaggattaaa gatatatttt aatacaaata ttgataaaaa aattattgcc      1020
     tgtgatccat ataatataga aaggataatt ttaaatatct tatctaattc gataaagttc      1080
     acaaaaccag gaggtgaaat caaaataagc ataacttctg atgaaaattt tgtatatatt      1140
     tctgtaagtg atacgggaat aggaatacca gagaatatga ttgacagaat ctttgagaga      1200
     tttgtacaag tggataaatc aacaatgagg cagaatgaag gtagcggtat aggtttatct      1260
     ttagtaaaag ggttagttga acttcataat ggaacaatat ctgttaatag cgtacttgga      1320
     aagggaagtg aatttattat taaactccca aataagataa cagaaaagga aaataacatt      1380
     tctcagttag ggcttatcag tgattcaaca gagaaggtaa gtattcaatt ctcggatatt      1440
     tattga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page