(data stored in ACNUC7421 zone)

EMBL: CP002160.PE467

CP002160.PE467       Location/Qualifiers
FT   CDS_pept        complement(600744..601010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfs:BF4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50258"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX0"
FT                   /inference="similar to AA sequence:KEGG:BF4188"
FT                   /protein_id="ADL50258.1"
FT                   /translation="MKKRIIYLLMAFSTYISILSTTVFAETTPLPEVQNTFSENIRTNG
FT                   SFGTSTLLTLRNKLIKKVRYVDTLFDNYILDKDITYKTAINYL"
     atgaaaaaaa gaattattta tttattaatg gcattttcta catacatatc tattctatca        60
     actacagtat ttgcagaaac tactccttta cctgaagttc aaaatacttt ttctgaaaat       120
     atacgaacaa atggtagctt tggcacttca acacttttaa ctcttagaaa caaattaatt       180
     aaaaaagtaa gatatgtaga tactctattt gataactaca tattagacaa agatatcacc       240
     tataaaacag ctattaatta tctatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page