(data stored in ACNUC7421 zone)

EMBL: CP002160.PE469

CP002160.PE469       Location/Qualifiers
FT   CDS_pept        603551..603964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0485"
FT                   /product="protein of unknown function CGGC region"
FT                   /note="PFAM: protein of unknown function CGGC region; KEGG:
FT                   cbe:Cbei_5051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50260"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX2"
FT                   /inference="protein motif:PFAM:PF08821"
FT                   /protein_id="ADL50260.1"
FT                   /translation="MDFKYVVIIQCEIAHKRCSGFACTNAFYNRDEVFAGYGENTRYIS
FT                   FTCGGCCGKGIASKLEHFSKKLKSKTSIEKNEVVIHLSSCMATDNYHYDRCPHLEYLKN
FT                   IIAKKGYTNVVEGSYISKGAARKREEEIYKTYE"
     atggatttta aatatgttgt aattattcaa tgtgaaattg ctcataaaag atgtagtggg        60
     tttgcttgta ctaatgcttt ttataatagg gatgaagtct ttgcaggcta tggagaaaat       120
     acaagatata tatcctttac ctgtgggggg tgttgtggaa aaggtattgc atcaaaatta       180
     gaacatttct ctaaaaagtt aaaaagtaag acaagtatag aaaaaaatga agtagtgatc       240
     cacttatcat catgtatggc aaccgataac tatcactatg atagatgccc acatctagaa       300
     tatcttaaaa atatcattgc gaaaaaagga tatacaaatg tagttgaagg ttcttatata       360
     agtaaagggg cagcaagaaa gcgagaagaa gaaatatata agacttacga ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page