(data stored in ACNUC7421 zone)

EMBL: CP002160.PE472

CP002160.PE472       Location/Qualifiers
FT   CDS_pept        607125..607751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbf:LBF_3233 serine phosphatase RsbU,
FT                   regulator of sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50263"
FT                   /db_xref="GOA:D9SQX5"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQX5"
FT                   /inference="similar to AA sequence:KEGG:LBF_3233"
FT                   /protein_id="ADL50263.1"
FT                   /translation="MKLKGILRKFLKDKNTRFITIDLSTTILMFSIVILATLIFIATML
FT                   SGLLVLIIGPIYTHVFQILLIGLIVALSVIFIILLAIKMFFIFSTVRTKNLMEVFCSGG
FT                   IKKMMQRIAMIFLIICSITFVLFKGSEKTVNTIRDIPHLIKNDYISIDGIIEIKDDTDG
FT                   TGYVRVDDTYFYEGFAYEPGVINGNKYHVEYLPHSKYIVNFTLIE"
     gtgaaattga aaggtattct aagaaaattt ttaaaggata aaaatacaag atttataact        60
     atcgatttat caaccacgat tttaatgttc agtattgtaa ttttagctac acttattttt       120
     attgctacaa tgcttagtgg attattagtt cttattattg gaccaattta tacacatgtg       180
     tttcaaattc ttttaatagg attaattgtt gctttaagtg taatctttat cattttatta       240
     gcaataaaga tgttctttat tttttctaca gttagaacaa agaacttaat ggaagttttt       300
     tgttctggcg gtataaagaa aatgatgcag aggattgcca tgatttttct aataatttgt       360
     tctataactt ttgttttgtt taagggaagc gaaaaaactg ttaatactat ccgtgatatt       420
     cctcatttaa taaagaatga ttatatttca attgatggaa taatagaaat caaagatgat       480
     acagatggga caggatatgt tagagtagat gatacttatt tttacgaagg ttttgcttat       540
     gaacctggag ttataaatgg aaacaaatat catgtggaat atttgccaca ttccaagtac       600
     atagttaatt ttacattgat tgaatag                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page