(data stored in ACNUC7421 zone)

EMBL: CP002160.PE489

CP002160.PE489       Location/Qualifiers
FT   CDS_pept        625536..626084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0505"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="KEGG: cpr:CPR_1102 phosphatase; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50280"
FT                   /db_xref="GOA:D9SQZ2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ2"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADL50280.1"
FT                   /translation="MLQAINQFDNSILWFIRDHLQSAVMDKLMIAISALGNVGIIWIVI
FT                   GILLAISKKYRKIGLVMLSALLLGALLGEGLLKNLVQRPRPSGFELIVKKPSSYSFPSG
FT                   HTTAAFASAMILSHYFKKYQIGIYTFAVLIAFSRLYLCVHYPTDVLGGMILGTTAALIV
FT                   LTVVKNLDKKKNIGLSSNL"
     atgttacaag caataaatca atttgataat tctatattat ggtttattag agaccactta        60
     caaagtgccg ttatggacaa gctgatgatt gcaatatctg cattgggtaa tgtagggatt       120
     atatggattg taataggaat tttattagct atcagtaaaa agtataggaa aataggacta       180
     gtaatgttat ctgctttatt attaggcgca ttattgggag aaggattatt aaaaaattta       240
     gtacaacgac caagaccatc tggatttgaa cttatagtga aaaagccatc atcatattcg       300
     tttccttcag gacacactac ggcagctttt gcatcagcaa tgattctttc acattatttt       360
     aaaaaatatc aaatagggat ttatactttc gcagttttaa tagcattctc tagattatac       420
     ttatgtgttc attatcctac tgatgttcta ggaggaatga ttttaggaac tacagcggct       480
     ttaatagtac ttacggtagt taagaattta gataaaaaga aaaacatcgg attatcaagc       540
     aatttatag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page