(data stored in ACNUC7421 zone)

EMBL: CP002160.PE491

CP002160.PE491       Location/Qualifiers
FT   CDS_pept        626990..627247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50282"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ4"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1345"
FT                   /protein_id="ADL50282.1"
FT                   /translation="MVSSWVNTTSNPGVTTPISIAQTGNKPDSVFDAYYETSRFANDQD
FT                   TLGLTSFYVYGNNVQSPAEWGPPNQNWGWTTIRLNPNGFN"
     gtggtaagta gttgggttaa tactacatcg aatccagggg ttacaactcc aatttctata        60
     gcacagacag gaaataaacc tgacagcgta tttgatgcat attatgagac aagcaggttt       120
     gctaatgatc aagatacatt aggattgaca tctttttatg tatacggtaa taatgtacaa       180
     tccccggcag agtggggacc tccaaatcaa aattggggat ggacaactat tagattaaat       240
     cctaatgggt ttaactag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page