(data stored in ACNUC7421 zone)

EMBL: CP002160.PE492

CP002160.PE492       Location/Qualifiers
FT   CDS_pept        627508..627801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfs:MFS40622_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50283"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ5"
FT                   /inference="similar to AA sequence:KEGG:MFS40622_0260"
FT                   /protein_id="ADL50283.1"
FT                   /translation="MKKALTISLGSILIFSLMGCSNGEKKEAQSNNTVVENEVSKSEPL
FT                   EIGNDDDKVNNDKNYDSLIIKTTQDVIRTFESFDELVKDSNVIIEGDIKRLA"
     atgaagaaag cattaacaat atccttagga tcaatcttaa tcttttcttt aatgggttgt        60
     agtaatggag agaaaaaaga agctcagagt aataatactg ttgtagaaaa tgaagtttct       120
     aaatcagaac cactagagat tggtaacgat gacgacaagg ttaacaatga taaaaattac       180
     gacagtttaa taataaaaac tacccaagat gttattagaa catttgaaag ctttgatgaa       240
     ttagtcaagg attccaatgt tataatcgaa ggagatataa aaaggctagc ataa             294
//

If you have problems or comments...

PBIL Back to PBIL home page