(data stored in ACNUC7421 zone)

EMBL: CP002160.PE496

CP002160.PE496       Location/Qualifiers
FT   CDS_pept        633218..633685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0512"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ctc:CTC01413 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; methylguanine DNA
FT                   methyltransferase ribonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50287"
FT                   /db_xref="GOA:D9SQZ9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ9"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADL50287.1"
FT                   /translation="MRSSVVIETIIGKIVITEENHTITNVDLYRDAVIENFFQKETPLL
FT                   KKAVKQLEDYFKGTLKEFDLPLAPNGTKFQQSVWRALQDIPYGETKSYGEVARSIGNPK
FT                   AARAVGMANNRNPIAIFIPCHRVIGVNGKLVGYGGGIDIKEILLGLEKSVK"
     atgagaagtt cagttgtaat tgaaacaata ataggtaaaa ttgtgataac agaagaaaat        60
     catactataa caaatgtaga tttgtataga gatgcagtta ttgaaaattt ttttcagaag       120
     gaaacaccgt tgctaaaaaa agcagtaaag cagctagagg attattttaa agggacacta       180
     aaagaatttg atttaccact tgcaccgaat gggacaaaat ttcaacaaag tgtttggcgt       240
     gctttgcaag atattcctta tggagaaaca aaaagctatg gagaggttgc aaggagcatc       300
     ggaaatccaa aggctgctag agctgtagga atggctaata acaggaaccc tattgcgatt       360
     tttataccat gtcatcgagt tattggagta aatggaaagc ttgtgggata tggtggaggg       420
     attgatataa aagagatact tttgggactg gaaaaaagtg ttaaatag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page