(data stored in ACNUC7421 zone)

EMBL: CP002160.PE5

CP002160.PE5         Location/Qualifiers
FT   CDS_pept        4556..4819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49796"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML1"
FT                   /inference="similar to AA sequence:KEGG:CLI_0005"
FT                   /protein_id="ADL49796.1"
FT                   /translation="MFLHLGENVVVPVRDVIGIFDIDTTMYGADTVQFLRLAEEDGFIE
FT                   KITNDKPKSFIVAEVNKKSKIFLSPISSATLCKRTQSIYEEY"
     gtgtttttac atttaggaga aaatgtagtg gttcctgtta gagatgttat aggcattttt        60
     gatatagata cgacaatgta tggtgcagat actgttcaat ttttaaggct agcagaggaa       120
     gatggcttta tagaaaaaat aacaaatgat aaaccaaagt catttattgt ggcagaggtg       180
     aataaaaagt ctaagatatt tttatcacct atctcttcag ctacattgtg taagagaaca       240
     caatctatat acgaggaata ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page