(data stored in ACNUC7421 zone)

EMBL: CP002160.PE500

CP002160.PE500       Location/Qualifiers
FT   CDS_pept        637215..638693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0516"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   lba:Lebu_1529 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50291"
FT                   /db_xref="GOA:D9SR03"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR03"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADL50291.1"
FT                   /translation="MRKSGVLLPVASLPSKYGIGAFSKNAYKFIDQLKAAGQSYWQILP
FT                   LGPTGYGDSPYQSFSTFAGNPYFIDLEELIAEGYLTEEECESYDFGDNERYIDYEKIYL
FT                   SRFKILKIAFGRSNIKETEEFQKFIANNAYWLEDYALYMAVKNYFDGVSWIKWDDDIRL
FT                   RKKSALEKYKSKLEDEIAFYQFQQFLFNKQWEALKEYANEADIKIIGDIPIYVAFDSAD
FT                   SWAHPELFQFDENGEPIAVAGCPPDGFSATGQLWGNPLYNWDYHEKTEYKWWVERIAYS
FT                   FKLYDVVRVDHFRGFDEYYSIPYGSETAEIGSWEKGPGYEIFKEVRKQLGEVNIIAEDL
FT                   GFLTESVLKLVEETGYPGMKVLEFAFDSREESDYLPHNYVKNCIVYTGTHDNETIVGWY
FT                   KNLNPDDKKLAIDYLDIKDKTDEDIHWKFIKLALSSVANLAIIPLQDYLGLGNEARINT
FT                   PSTVGGNWKWRLLEDEITEELVEKINKVTKLYGR"
     atgagaaaaa gtggagtttt actaccagtt gccagtttac cttcaaagta cggaataggt        60
     gcattttcta aaaatgcata taagtttata gatcagttga aagcagcagg acaaagctat       120
     tggcaaatac tgcctttagg gcctactgga tatggggatt cgccatatca atccttttca       180
     acctttgctg gaaatccgta ttttattgat ttggaagaat taattgctga aggatattta       240
     actgaagaag aatgtgaatc ttatgatttt ggagataatg aaagatatat agactacgaa       300
     aaaatatact tatctagatt taaaatttta aaaattgctt ttggaagaag taatataaaa       360
     gaaacagaag agtttcaaaa gtttattgca aacaatgctt attggttaga agattatgct       420
     ttatatatgg cagtaaaaaa ctatttcgac ggtgtaagtt ggattaagtg ggatgatgat       480
     ataagattaa gaaaaaagtc tgcacttgaa aaatataaaa gcaagcttga agatgaaatt       540
     gccttttatc aatttcagca attcttattt aacaaacaat gggaagcatt gaaagaatat       600
     gccaatgaag ctgatattaa gattattgga gatattccca tctatgtggc ttttgatagt       660
     gcagatagct gggcacatcc agagttattc caatttgatg aaaatggaga accaattgct       720
     gtagcaggct gtccgccaga cggtttctct gctacagggc aattgtgggg caaccctctt       780
     tataattggg actaccatga gaaaactgaa tataagtggt gggttgaaag aatagcttat       840
     tcctttaagt tatatgatgt tgtacgtgtt gatcatttca gaggctttga cgaatactac       900
     tcaatacctt atgggtcaga aacagcagag attggaagtt gggaaaaagg tcctggctac       960
     gagattttta aagaagtacg gaagcaatta ggtgaagtaa atataatagc agaagattta      1020
     ggctttttaa cagaaagtgt tttgaaactt gttgaggaaa ccggttatcc aggtatgaaa      1080
     gtattagaat ttgcttttga ttcaagagaa gaaagtgatt atttacctca taattatgtg      1140
     aagaattgta ttgtttatac tggaacacat gataatgaaa caattgtagg atggtataag      1200
     aatttaaatc cagatgataa gaaattagct attgattatt tggacatcaa agataagact      1260
     gatgaggata ttcattggaa atttataaaa ctggcacttt ctagtgtcgc aaacttagca      1320
     attataccat tacaggatta tttaggatta ggaaatgagg ctagaattaa taccccttca      1380
     acagtggggg gaaattggaa atggcgttta ttagaggatg aaattactga ggaattagta      1440
     gagaaaataa acaaggttac aaagttatat ggaagataa                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page