(data stored in ACNUC7421 zone)

EMBL: CP002160.PE505

CP002160.PE505       Location/Qualifiers
FT   CDS_pept        645487..646530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0521"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="KEGG: ckr:CKR_1675 hypothetical protein; TIGRFAM:
FT                   sulfate ABC transporter, periplasmic sulfate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50296"
FT                   /db_xref="GOA:D9SR08"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR08"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ADL50296.1"
FT                   /translation="MRKNRFLSIALSAILLGAILTGCGSSSSGSDKQNSSSGVELLNVS
FT                   YDPTREFYTEYNRAFIKYWGEKTGQDITINQSHGGSGKQGRSVIEGLEGDVVTLALAYD
FT                   IDEISNAGLINKDWQGEFQNNSTPYTSTIVFLVRKGNPKGIKDWDDLVKEGVSVITPNP
FT                   KTSGGARWNYLAAWAYALNKNNGSEDDAKSFVGDLYKNVEVLDSGARGATTTFVERGIG
FT                   DVLIAWENEAYLSLNELGSDKFEIVVPSISILAEPPVAIVDEVAEKKGTTEVAKAYLEY
FT                   LYSDEGQEIIAKNYYRPRNSKIAEKYKNTFKDVKLFTVDDTFGGWTKAQATHFADGGVF
FT                   DEIYSPK"
     atgaggaaaa acagattttt aagtatagca ttatcggcaa tattattagg agctatatta        60
     actggatgcg gttcatcatc ttcaggtagt gataaacaga atagttcttc tggagttgaa       120
     ttattgaatg tttcatacga tcctactaga gaattttata cagaatataa tagggctttt       180
     ataaagtact ggggggagaa aactggacaa gatattacga taaaccaatc gcatggtggt       240
     tctggaaagc aaggtcgttc tgtaattgaa ggattagaag gtgatgtagt taccttagca       300
     ctagcctatg atatagatga aattagcaat gcagggctta ttaacaagga ttggcaaggg       360
     gaatttcaaa ataatagcac tccatataca tctacaatag tttttctagt gagaaaggga       420
     aatcctaagg gtattaaaga ctgggatgat ttggttaaag aaggggtttc cgttataaca       480
     ccaaatccta aaacttctgg tggagctaga tggaactact tagcagcttg ggcatatgca       540
     ctaaataaga acaacggaag tgaagatgac gctaaaagtt ttgtaggaga tctttataaa       600
     aacgttgaag tgctggattc aggtgctaga ggggcaacaa caacttttgt tgaaagaggt       660
     attggtgatg tattaatagc ttgggaaaat gaggcttatc tttctctgaa tgaattagga       720
     agtgataagt ttgaaatagt tgttccatct atcagcattt tagcagagcc accagttgcc       780
     atagttgatg aagttgcaga gaaaaaagga acaacggaag tagctaaagc atacttagag       840
     tacttatata gtgatgaagg acaagaaata atagctaaaa attattatcg tcctagaaat       900
     tccaaaatag cagaaaaata taagaatact tttaaagacg ttaagttatt tactgtagat       960
     gatacttttg gtggttggac aaaggctcaa gctacacact ttgcagatgg tggggtattt      1020
     gatgaaatat attcccctaa ataa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page