(data stored in ACNUC7421 zone)

EMBL: CP002160.PE507

CP002160.PE507       Location/Qualifiers
FT   CDS_pept        647393..648220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0523"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="KEGG: cbe:Cbei_4191 sulfate ABC transporter, inner
FT                   membrane subunit CysW; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysW; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50298"
FT                   /db_xref="GOA:D9SR10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR10"
FT                   /inference="protein motif:TFAM:TIGR02140"
FT                   /protein_id="ADL50298.1"
FT                   /translation="MKKELKTENTITKWILIFISVAFLILMLGFPLAVVMIEALKKGFG
FT                   AYVKAITDNYTLKAVSLTLLATLVATIVNTIFGIFAAWAITKFKFKNKNILTTLIDIPF
FT                   AISPVIAGLIFILTFGRIGWLNGLLSAIDAKIVFAIPGIILATIFVTFPFVSREIIPLM
FT                   NSQGTDEEEAAAMMGASGFKIFTKITLPNIKWGLIYGIILCTARAMGEFGAVSVVSGHI
FT                   RGKTNTLPLHVEILYNEYQFSAAFAVSSLLVIIAIVVLILRNIVEWKAKKGDL"
     ttgaaaaaag aattaaaaac agaaaataca ataacaaaat ggattcttat ttttataagt        60
     gttgcctttt taatattgat gttagggttt cctcttgctg ttgtaatgat tgaagcactt       120
     aaaaaaggtt ttggtgctta tgttaaggcc ataacagata attatacttt aaaagcagtg       180
     tcccttacct tgcttgctac actagtagcc acaatagtaa acacgatatt tggtattttt       240
     gctgcatggg ctattactaa gtttaaattt aaaaataaaa atatattaac tacattgata       300
     gatatacctt tcgccatatc tcctgtaatt gctggactta tatttatatt aacctttgga       360
     cgtatcggat ggcttaatgg tttattatct gcaattgatg caaaaatagt ttttgctatt       420
     ccaggaatta ttttagctac gattttcgtt acgttcccat ttgtatcaag agaaataatt       480
     ccacttatga attctcaagg aacagatgaa gaagaagctg cggcaatgat gggagctagt       540
     gggtttaaaa tcttcacgaa aataactctt cctaatatta aatggggact tatttatgga       600
     attatacttt gtactgcaag agctatggga gagtttggag ctgtttctgt tgtatcagga       660
     catatcagag gaaaaactaa tacattgcct ttgcatgtag agattttata taatgaatat       720
     caattttcag cagcctttgc tgtttcatca cttttagtaa taatcgcaat agttgtcttg       780
     attttgagaa atatagttga atggaaagct aagaaggggg acttataa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page