(data stored in ACNUC7421 zone)

EMBL: CP002160.PE509

CP002160.PE509       Location/Qualifiers
FT   CDS_pept        649410..651086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0525"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: cbe:Cbei_4189
FT                   adenylylsulfate reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50300"
FT                   /db_xref="GOA:D9SR12"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR12"
FT                   /inference="protein motif:PFAM:PF02910"
FT                   /protein_id="ADL50300.1"
FT                   /translation="MKINKLSTDILIIGGGTAGCYAAITISESSDAKVIIAEKANIKRS
FT                   GCLAAGVNAINAYIVKGNKPEDYVDYAKKDADNIVREDLLLTMAERLNDVTKKLEDLGL
FT                   VILKDENGQYVARGNRNIKINGENIKPILADAVNKLHNVAVINKINIIDFILEDGKVVG
FT                   AYGIGVNEEVFYVIEAKAVICATGGASGLYRPNNPGFSRHKMWYSPFNTGAGYAMGIRA
FT                   GAEMTTFEMRFIALRCKDTIAPTGTIAQGVGAKQVNSLGEEYESKYGITTSQRVYGTVQ
FT                   ENLAGRGPCYLKTEGISAVQDDQLLKAYLNMAPSQTLKWIEENKKPSEQNVEIEGTEPY
FT                   IVGGHTASGYWIDTKRATTIKGLYAAGDVAGGCPQKYVTGALVEGEIAANSALEYINGY
FT                   EKIEIKENIIDKRFNEVTAMFSKEDSIYDVEKLEDAMQKVMDNYAGGIKTNYQYNEKQL
FT                   NLADEKIDNIIRLSEGIKAKDIDDLVQIFELKDRLVVCKSVIAHLRARKETRWHSFAEN
FT                   LDYPEKDDSWLKYVNSKVVDGNLEIIYRDLVYRGEIYEHID"
     atgaagatta ataaattaag tacggatatt ttaattatag gtggtggaac tgcaggatgt        60
     tacgctgcaa taacaatttc tgaaagttct gatgctaagg tgattattgc tgaaaaagca       120
     aatataaaac gaagtggctg cttagcagct ggtgttaatg ctattaatgc ctatattgtt       180
     aaaggaaata aaccagaaga ttatgttgat tatgcaaaga aggatgctga caatattgtt       240
     cgtgaggatt tacttttaac tatggctgaa agattaaatg atgtaacaaa aaaacttgag       300
     gatttagggt tagtaatttt aaaggatgag aatggccaat atgtagcaag aggaaataga       360
     aatatcaaaa tcaatggtga aaatattaaa ccaatcttag cagatgctgt aaacaagcta       420
     cacaatgttg cagtgataaa taaaatcaat atcattgatt ttattttaga agacggaaaa       480
     gtagtaggtg cctatggtat aggggttaac gaggaagtct tttatgtaat agaagcaaaa       540
     gctgttatat gtgcaactgg tggtgcttct ggactttaca gaccaaataa tccagggttc       600
     tcaagacata aaatgtggta cagtccattt aatacaggtg ctggttatgc aatgggtata       660
     agagccgggg ctgaaatgac taccttcgag atgagattta ttgctctaag atgtaaagat       720
     accattgcgc caacaggtac aatagctcaa ggtgttggag caaaacaagt gaattctcta       780
     ggagaagaat atgagagtaa atatggaatt acaacttctc agcgtgttta tggaacagtt       840
     caagaaaatt tagctggaag aggtccatgc tatctaaaga ctgaaggaat ttcagcggtg       900
     caagatgatc agttgctaaa ggcgtattta aatatggctc ctagtcaaac acttaagtgg       960
     atagaagaaa ataagaaacc tagtgaacag aatgtagaaa ttgagggaac agaaccatac      1020
     attgtaggtg gtcatacagc tagtggttat tggatagata ctaaaagagc aaccactatt      1080
     aagggcttat atgcagctgg tgatgtagct ggtggatgtc ctcaaaaata tgttactggt      1140
     gcattagtag aaggtgaaat agctgctaat tcagctttag aatatataaa tggctatgaa      1200
     aagatagaaa tcaaagagaa tatcatcgat aagagattta atgaagttac tgcaatgttt      1260
     agtaaagaag attctatata tgatgtagaa aagttagaag acgctatgca aaaagttatg      1320
     gacaactatg caggcggaat aaaaaccaac tatcaataca atgagaaaca attaaacctt      1380
     gcagatgaaa agattgataa cataataaga cttagcgaag ggattaaagc taaagacatt      1440
     gatgatttag tgcagatttt tgagttaaaa gatagattgg tagtttgtaa aagtgttatt      1500
     gctcatctaa gagcaagaaa agaaacaaga tggcatagct ttgctgaaaa tttagattat      1560
     ccagagaagg atgattcatg gcttaaatat gtaaattcca aagttgttga tggaaacctt      1620
     gaaataatct acagagactt agtttacaga ggtgagatat atgagcatat cgattga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page