(data stored in ACNUC7421 zone)

EMBL: CP002160.PE511

CP002160.PE511       Location/Qualifiers
FT   CDS_pept        651458..652258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0527"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: csc:Csac_1642 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50302"
FT                   /db_xref="GOA:D9SR14"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR14"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADL50302.1"
FT                   /translation="MDHLDLLEAQSIFILREAYKKLGKLGMLWSIGKDSTVLLWLAKKA
FT                   FYGHCPFPFIHVDTTYKIPEMIQYRDRVAKELNLDLIVHTNKEAIEAGMGPDQGRLVCC
FT                   KALKTEALQDVVRVYGFEGLIVGVRRDEEGSRSKERVFSERNKEYEWDYSNQPPELWDQ
FT                   FKTDFPKGNHIRVHPLLHWNELDIWEYIKRENIPIIDLYFSKNGERYRSLGCAPCTGRI
FT                   KSEAKNLDEIIEELRHTTTGERAGRAQDQEDSYAMQKLRKDGYM"
     atggatcatt tagatttatt agaggcgcaa agtattttta tattaagaga agcatacaaa        60
     aaattaggta aactcggaat gctttggtca attggtaagg attctacagt tttattatgg       120
     ctagctaaga aagcttttta tggacactgt ccattcccat ttatacatgt tgatacaact       180
     tataaaattc cagaaatgat acaatacaga gaccgtgttg ctaaagaatt aaatttagat       240
     ttaattgttc acacaaataa agaagctatt gaagctggaa tgggtcctga ccaaggtaga       300
     ttagtttgtt gtaaagctct taaaacagaa gcacttcagg atgttgttag agtttacggc       360
     tttgagggac ttattgttgg agttagacgt gatgaagaag gttcacgttc aaaagaaaga       420
     gtatttagtg aaagaaacaa agagtacgag tgggattatt caaatcaacc accagagctt       480
     tgggatcaat ttaagacaga cttccctaag ggaaatcata taagagttca tcctctttta       540
     cattggaatg agttagatat ttgggaatat ataaaaagag aaaatattcc tatcatagat       600
     ttatatttct caaaaaacgg agaaagatac agaagccttg gttgtgctcc atgtactgga       660
     agaattaaat cggaggcaaa aaatcttgat gaaatcattg aagaattgag gcatacaacc       720
     actggggaac gtgctggacg tgctcaagac caagaagatt cttatgcaat gcaaaagctt       780
     cgtaaggatg gatatatgta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page