(data stored in ACNUC7421 zone)

EMBL: CP002160.PE512

CP002160.PE512       Location/Qualifiers
FT   CDS_pept        652312..654009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0528"
FT                   /product="sulfate adenylyltransferase, large subunit"
FT                   /EC_number="2.7.7.4"
FT                   /note="TIGRFAM: sulfate adenylyltransferase, large subunit;
FT                   small GTP-binding protein; KEGG: csc:Csac_1643 sulfate
FT                   adenylyltransferase, large subunit; PFAM: protein synthesis
FT                   factor GTP-binding; elongation factor Tu domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50303"
FT                   /db_xref="GOA:D9SR15"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR15"
FT                   /inference="protein motif:TFAM:TIGR02034"
FT                   /protein_id="ADL50303.1"
FT                   /translation="MSEKQNTLKIVVVGHVDHGKSTVIGRLLHDTQSLPEGTINKVKRI
FT                   AKETGKPFEYAYLLDAFEEEQKQGITIDTTQIQFQTKKRDYVIIDAPGHKEFLKNMISG
FT                   AANAEAALLVIDVKEGVQEQSKRHAYILSLLGIKKVYVVLNKMDLVDYSEEVFNDVSTA
FT                   MNKFLGELDVYPLAYIPVSAYYGENILDDSTKMPWYKGQSIINAIDSLENEKGIEERSL
FT                   RFPIQDVYKFDDRRIIAGRIESGKLKVGDEIVIYPEGKKTQVKTIEYWVEKDKKDEIKA
FT                   GESVGITVTDEFFNKRGEIITKAENPPFISNSFRANIFWMGKNDLVKNKKYKIKLTTQE
FT                   VEGEIDKIIKVIDASSLNSNEEVSKVVLNDVAEVIIKTKEPVVFDAFKDSQITGRFVIV
FT                   DGYDVAGGGIVVKSEEGEVVQGLETFKFQGVKARGDIFEEFYYDVESQTVNKEIATTNT
FT                   YTVGDSLPLKGESYEYPSYFDILVIRDKVAIAVRDGKVNNIVALEDYQYSGYPLTNGRG
FT                   FEIKAKTSEEIKDFVEGYSNIDEKTEAEYLNKWVNFDTYRKVVFRFDK"
     atgagtgaaa aacaaaatac tttaaaaata gttgtggttg gacacgttga ccacggtaaa        60
     tcaacagtaa taggacgttt acttcatgat acacaatcgc taccagaagg tactatcaac       120
     aaggttaaaa gaattgcaaa agagacagga aagccttttg agtatgctta tcttttagat       180
     gcttttgaag aagaacaaaa gcaaggtatt acaattgata caactcaaat tcagtttcaa       240
     accaaaaaga gagattatgt tataattgat gccccaggtc ataaagagtt cttaaaaaat       300
     atgatatctg gtgctgctaa tgcagaggct gcattacttg ttattgatgt taaagaagga       360
     gttcaagaac aatcaaagag acacgcttat attctttcct tgcttggtat taagaaggta       420
     tatgtagtat taaataagat ggatttagtt gattattctg aagaagtatt caatgatgta       480
     tcaacagcta tgaataagtt cctaggagaa ttagacgttt atccacttgc atatattcct       540
     gtatccgcat actatggtga aaatatttta gatgattcaa ctaagatgcc ttggtataaa       600
     ggacaatcaa taataaatgc tatagatagt cttgaaaatg aaaaagggat agaagagaga       660
     tctttaagat ttccgattca agatgtgtac aagttcgatg atagacgtat tatagctgga       720
     cgtattgaaa gtgggaaatt aaaagttggc gatgaaattg ttatctatcc agaaggtaaa       780
     aagactcagg taaaaaccat tgagtactgg gtagaaaaag ataaaaaaga tgaaataaaa       840
     gctggagaat ctgttggtat tactgttaca gatgagttct tcaataaacg tggagaaatt       900
     attactaagg cagaaaaccc tccttttata tctaactctt ttagagcaaa tattttctgg       960
     atgggtaaaa atgatttagt taagaacaag aaatacaaaa ttaagcttac aactcaagag      1020
     gttgaaggtg aaattgataa aattattaaa gttatcgatg cttctagctt aaatagtaat      1080
     gaagaagtaa gtaaagtagt tttaaatgac gtagcggaag taatcataaa gacaaaagaa      1140
     ccagtagtct ttgatgcgtt caaagatagt caaattactg gaagatttgt aattgttgat      1200
     ggttatgatg ttgctggtgg tggtattgtt gttaagagcg aggaaggcga agtagtacaa      1260
     gggttagaaa ctttcaagtt ccaaggcgta aaagcaagag gagatatctt tgaagaattc      1320
     tattatgacg tagaaagtca aacagtaaac aaagaaatcg ctactactaa tacctatact      1380
     gttggagatt ctttaccatt aaagggtgaa agctatgaat accctagcta tttcgatatc      1440
     ttagttatta gagataaggt tgcgattgca gttagagatg gtaaggttaa taacattgta      1500
     gctttagagg attatcaata ttcaggatat ccgttaacta atggaagagg ttttgaaatt      1560
     aaagctaaaa cttctgaaga aattaaagat ttcgtagaag gttatagtaa tatagatgaa      1620
     aagacagaag ctgagtattt aaataaatgg gttaactttg atacttatag aaaagtagtt      1680
     ttccgttttg ataaatag                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page