(data stored in ACNUC7421 zone)

EMBL: CP002160.PE517

CP002160.PE517       Location/Qualifiers
FT   CDS_pept        658951..659409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0533"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: cdl:CDR20291_1716 putative thiol peroxidase
FT                   (bacterioferritin comigratory protein); PFAM: alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50308"
FT                   /db_xref="GOA:D9SR20"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR20"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADL50308.1"
FT                   /translation="MLMEGSKAPEFKLEDKDGNEVRLSDFLGKKVVVYFYPKDNTPGCT
FT                   RQACAFKDSYEGFKAKEIVVIGISKDSTKSHEKFAEKHGLPFTLLSDPELIVIKAYDVW
FT                   KEKKLYGKVSMGVVRTTYIINENGIIEKVFEKVKPDTNAKEILDYLEG"
     atgttaatgg aaggaagtaa agcgccagaa tttaagttgg aagataagga tggaaatgag        60
     gttagattat cagatttttt aggaaaaaag gtagtggtgt acttttatcc taaagataat       120
     acaccaggtt gtactaggca agcttgtgcc tttaaagatt cttatgaagg atttaaagca       180
     aaagaaattg tagttatagg aatcagcaaa gatagtacta aatctcatga aaagtttgca       240
     gaaaagcatg gcttaccatt tacattacta tcagatccag aattaattgt tattaaagcc       300
     tatgatgtat ggaaagagaa aaagttatac ggtaaggtta gtatgggagt agtaagaacc       360
     acatacataa tcaatgagaa tggcataata gaaaaggttt ttgaaaaagt aaaacctgat       420
     acaaatgcta aggaaatatt agattattta gaaggttaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page