(data stored in ACNUC7421 zone)

EMBL: CP002160.PE518

CP002160.PE518       Location/Qualifiers
FT   CDS_pept        659742..660278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0534"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   cbe:Cbei_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50309"
FT                   /db_xref="GOA:D9SR21"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR21"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADL50309.1"
FT                   /translation="MKVKILPGLNNSGADHWQSIWEKKYGFERVQQDDWKQPKYNEWEK
FT                   NLIDNLQRENDKNIILIAHSLGCLLTAKAITKIEDYVKAIFLVAPPDTSRDIFPKEINS
FT                   FNNLPNKTLGVPGILVYSEDDQYASAEYSLKQAKNWGLQAVSVGKRGHINSDSNIENWD
FT                   QGYEIFQKLLINEER"
     atgaaagtaa agatacttcc tggattaaat aattctgggg cagatcattg gcagagcatt        60
     tgggaaaaga aatacggctt tgagagagta caacaagatg actggaaaca gcctaaatat       120
     aatgagtggg agaaaaactt gatagataat ctccaacgtg aaaatgacaa aaatattatt       180
     ttgatagctc atagcttagg atgcttactt actgcaaaag caataactaa gatagaagat       240
     tatgtgaaag ctattttttt agtagcacca ccagatacta gtagggatat attcccaaaa       300
     gaaattaatt cattcaataa tttgcccaat aaaactttag gggttcctgg catactagta       360
     tatagtgaag atgatcaata tgcgtcagca gagtacagct taaaacaagc taaaaactgg       420
     gggcttcaag cagtatctgt tggaaaaaga ggccatatta acagtgactc taacatagaa       480
     aattgggatc aaggttatga gatatttcaa aaacttttaa taaatgaaga gcgatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page