(data stored in ACNUC7421 zone)

EMBL: CP002160.PE519

CP002160.PE519       Location/Qualifiers
FT   CDS_pept        660440..660946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0535"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: cbe:Cbei_2322 metal dependent
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50310"
FT                   /db_xref="GOA:D9SR22"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR22"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADL50310.1"
FT                   /translation="MRNVGNVISAMIEYYAGDVRRINHFLKVYGFAKAIGEMEKLSPLK
FT                   QEILEVASVVHDIGIKNSEIKYNSSAGNYQQIEGPPVAEEMLKKLGYEDNFIKRVCFLI
FT                   AHHHTYTDIDNYDYQILVEADFLVNIDEDQLSMDVVRSVKEKIFRTEVGIKYLNVLYNI
FT                   DNIGI"
     atgagaaatg taggaaatgt tataagtgca atgatagaat attatgctgg agatgtaaga        60
     cgtattaatc actttttaaa agtctatggt tttgctaaag ctataggaga aatggaaaag       120
     ttaagcccgt taaagcaaga aattttagaa gttgcttcag ttgtacatga tataggtatt       180
     aagaatagtg aaataaaata taattctagt gctggtaatt atcagcaaat tgaaggacca       240
     ccagtagcag aagaaatgct taaaaagtta ggatatgaag ataattttat aaaaagagtg       300
     tgtttcttaa ttgctcatca tcatacgtat actgatattg ataattatga ttatcagatt       360
     cttgtagaag cagatttttt agttaatatt gatgaagatc agttatctat ggatgttgtt       420
     agatcggtaa aagaaaagat atttaggaca gaagtaggaa ttaaatattt gaatgtgtta       480
     tataatattg ataatatagg tatttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page