(data stored in ACNUC7421 zone)

EMBL: CP002160.PE524

CP002160.PE524       Location/Qualifiers
FT   CDS_pept        668228..670285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0542"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: cac:CAC3352 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; Cache domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50315"
FT                   /db_xref="GOA:D9SR27"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR27"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50315.1"
FT                   /translation="MKKISSSIIAAIIICVILSSISVGTISIFIGYRSVKGEAVDKLQA
FT                   TAMQYANKMNNNFTEAEGAVNGLASYIEASFDMSKIQDKGYDNDFNKALTEQLRILEKN
FT                   NENILGIYAYMEPSYTKSIIGNWFSDGKLITLKLDEEYKLYSDHAESWDFYYEAVENNK
FT                   PAWIDPYYDEDLKFDVVSYLYPVYVDNKLWGVVGMDISFDDFSELVNEMKLYDSGYAFL
FT                   LNQNQNFIVHPEYSNEETLETVGYDKLITKLEESNDGFTQMNIDGKEEYVGYSVLENGY
FT                   VFCTTVPSVEILKSIKTMIIISVLAIAISISIAFIVAVVLGKRISMPISKVAMDLELAG
FT                   DGDFTGRESLAYIRNHDETGILSKALDKMQKSMEAMIDRISNESSEVSDITRELKSVMD
FT                   SLIAEVLNISDITERISAGMEETAATATTIDSASNRMIDQINLMNEKNDHGIKIVEEIS
FT                   KHATSLRESAVKEAQIVNDICISAEAKLSNAINDSKEVSKIKELSENILAIAEQTNLLS
FT                   LNASIEAARAGEMGKGFAVVANEIKKLADDSQKLASEIQSITNGVTNSVGNLCESAEEV
FT                   LDFVNNNVKESYEMLINTSEQYNNDANVVYDMLSDFNRVSYTIFEEINELLRAFNDISV
FT                   AANEGAVGTSDISTRVQEVSYNTKIIEEQFKKLIEVSEKLNSIMHMFKVV"
     atgaaaaaaa tatcatcttc aataattgct gcaataataa tttgtgtaat tttatcttca        60
     atttctgtgg ggactataag tatttttata gggtatagaa gtgttaaagg ggaagctgtc       120
     gataagttgc aggcaacagc tatgcagtat gcaaacaaaa tgaataacaa ttttaccgag       180
     gcagaggggg ctgttaatgg acttgcaagt tatattgaag cttcctttga tatgagtaaa       240
     atacaagata aaggttatga taatgatttt aataaagctc tcacagaaca gttaagaata       300
     ttagaaaaaa ataatgagaa tattctcggt atatatgcat atatggaacc atcatacaca       360
     aagtctataa ttggtaattg gtttagcgat gggaagttaa taactttaaa gctagatgaa       420
     gaatataaat tatattcaga ccatgctgaa agttgggatt tttattatga agcagttgag       480
     aataataagc ctgcgtggat agatccttat tatgatgaag atttaaaatt tgatgtggta       540
     tcttatttat accctgttta tgtagataat aagttatggg gtgttgtggg aatggatatt       600
     tcttttgatg atttttctga gttagtaaac gaaatgaaat tatatgacag cggatatgca       660
     ttcttattaa atcaaaatca gaattttata gtacatcccg agtattcaaa tgaggagact       720
     ttagaaaccg taggttatga taaactaatt acgaaattgg aagaaagtaa tgacgggttt       780
     actcagatga atattgatgg aaaagaagag tatgtaggtt attcagtttt ggagaatggg       840
     tatgtatttt gtactacggt tcctagtgtt gaaattttga aatcaattaa aaccatgata       900
     attatatctg tcctagcaat agcaataagc atctctatag catttattgt agcagtagtg       960
     ttaggaaaaa ggatatctat gccaatttca aaggttgcta tggatttaga attggctggt      1020
     gatggagatt tcacaggaag agaatcttta gcatatataa gaaatcatga tgagacaggt      1080
     atcctatcta aagctcttga taaaatgcaa aagtctatgg aggctatgat agatagaata      1140
     tctaatgaaa gcagtgaagt ttctgatatt actagagaac taaagagtgt aatggacagt      1200
     ctgatagcag aagttttaaa tatttctgat ataacagaaa gaatatcagc aggaatggaa      1260
     gaaacagcag ctacagctac aacaattgat agtgcatcaa atagaatgat agatcaaatt      1320
     aatcttatga atgagaagaa tgatcacggc ataaagattg tagaggaaat tagtaagcat      1380
     gcaacatcat taagggaatc agcagttaaa gaagctcaga ttgttaatga tatatgtata      1440
     agtgctgagg caaaactttc taatgcgata aatgattcta aagaggttag taagattaaa      1500
     gagttatctg aaaatatatt ggctattgca gaacaaacaa acttgttatc attaaatgct      1560
     tctattgaag cagctagagc tggggaaatg ggtaaaggtt ttgcagtagt tgcaaatgaa      1620
     attaaaaagt tagcagatga ttctcaaaaa ttagcaagtg aaattcaaag tattactaat      1680
     ggagttacaa attcagtagg taatttgtgt gagagtgctg aggaagtgtt agattttgtt      1740
     aacaataatg ttaaagaaag ttatgagatg ttaataaata ctagtgagca atataataat      1800
     gatgctaatg ttgtttacga catgctatct gattttaata gagtttcata tacaattttt      1860
     gaagaaatca acgaactttt aagggctttc aatgatatta gtgttgcagc aaatgaggga      1920
     gctgtaggaa cttcagatat ttcaactcga gtacaagagg tttcttataa cactaagatt      1980
     attgaagaac aatttaaaaa gctaatagaa gtatcagaaa agcttaatag tataatgcat      2040
     atgtttaagg tagtataa                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page