(data stored in ACNUC7421 zone)

EMBL: CP002160.PE526

CP002160.PE526       Location/Qualifiers
FT   CDS_pept        671991..672509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0544"
FT                   /product="membrane spanning protein"
FT                   /note="KEGG: cbe:Cbei_0760 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50317"
FT                   /db_xref="GOA:D9SR29"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR29"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0760"
FT                   /protein_id="ADL50317.1"
FT                   /translation="MEKSRTQKMILSALFIAMIFVATRINIKLPLGNGGLVHLGTAFLF
FT                   IIAVNFGTRYGAISGALGMTIFDVLSGWAAWAPTTFVARLVMGYIVGKMNEKREKGNIL
FT                   IMLASFVISGVFMIAIYYIGNAITFGNWIAPIQSIPGDITQIVIGALIALPATKAIERI
FT                   NILKRYRWD"
     atggaaaaat caagaacaca aaagatgata ttaagtgcgc tttttatcgc aatgatattt        60
     gttgctacta gaattaatat taagttacct ttaggaaatg gagggcttgt gcatttagga       120
     actgcgtttc tatttataat agctgtaaac tttggaacta gatatggggc tatctctgga       180
     gctttgggaa tgactatttt tgatgtgtta tcaggatggg cggcttgggc acctactacc       240
     tttgtagcaa gattagtaat gggatatata gtaggaaaga tgaatgagaa acgtgaaaaa       300
     ggcaatattt taataatgct agcttctttc gtaatttcag gagtatttat gatagcaata       360
     tattatattg gtaatgcaat tacctttgga aattggatag caccgataca atctattcct       420
     ggagatatta ctcaaattgt tattggagct ttaatagcat tgccagcaac taaggctata       480
     gaaagaataa atattttaaa gagatatagg tgggattaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page