(data stored in ACNUC7421 zone)

EMBL: CP002160.PE528

CP002160.PE528       Location/Qualifiers
FT   CDS_pept        673933..676011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0546"
FT                   /product="Lecithin:cholesterol acyltransferase"
FT                   /note="PFAM: Lecithin:cholesterol acyltransferase; type 3a
FT                   cellulose-binding domain protein; KEGG: mla:Mlab_0281
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50319"
FT                   /db_xref="GOA:D9SR31"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR31"
FT                   /inference="protein motif:PFAM:PF02450"
FT                   /protein_id="ADL50319.1"
FT                   /translation="MKKKVCLLTLVFAIAITNLFSTIASAAGATTKRQAVLVIPGIMGS
FT                   NLVDSDGDTVWVTDEWIAGSKQLYYLLNGTISCTSSGFSSETIIPKLGTNEYGAKDTYK
FT                   DLVNRLKGEFQNDYDVIFAAYDWRVDNTRSAMELKKTIDNYDNVIIVAHSMGGLVTSRY
FT                   LQMYGGSKVDKVITLGTPYWGAVSAAETMYTGEVSVLPDIVRGAMSGTMRDLVTNYPSM
FT                   HQLLPNTYYTNKSNWLTTEKRVYEKWYDYVWPRTKDILNNTADTQQFYKDNFNSSLVTV
FT                   ATNFHNSLYSSTAPIKLVDNTVIVGNGVNTVTSVKLATNSILGIKSRLSVPKYTTSGDG
FT                   TVPFLSATIGNGVNYIQRNGIDHTGLVKDPTTLTMVVDSIRGAIASKASVVRSAVSAQG
FT                   SPIDYKLTFAGDLNFQAIKDNTVVSSIDKLPMEDQNYYNVKDAKEVKIDNIGTVGEDNA
FT                   YLATFTQAGYTFKFKSNKDQKIDFAVGPNNLIFGFDNINLNEGADVYVNMTSQENISAA
FT                   IDNNADGVVDSVVNPTIKDLSEDITANDLVVYSSDRNAYNKLDNSLYPQMKVKNVSNKT
FT                   INLSDLELRYFFNNDGNDNNKFECDWAGLNNGTINASVKSDFVSNENGDTMLTIGFVND
FT                   GKVLMPGQEIEVQGRIHNDKWSIYNKSNDYSFSGQAYTVNSKVVLYAKDLLIFGVTP"
     atgaaaaaga aggtgtgttt gctgacattg gtttttgcaa ttgcaattac gaatttgttt        60
     agcacgatag cttcagcagc aggagctaca acgaagagac aagctgtttt ggtgattcct       120
     gggataatgg gatcaaattt agtagatagt gatggagaca ctgtatgggt taccgatgag       180
     tggattgctg gaagtaaaca gttgtactac ttactcaatg gaactatttc ctgtacaagc       240
     tctggtttta gttcagagac aataattcca aagttaggaa caaatgaata tggagctaaa       300
     gatacatata aggatttagt caatagacta aaaggtgaat ttcagaacga ttatgatgta       360
     atatttgctg cctatgactg gagagtagac aacacaagaa gtgctatgga attaaagaag       420
     acaatagata attatgataa tgtaattatt gtagctcata gtatgggcgg tcttgtaaca       480
     agtagatacc ttcaaatgta tggtggaagt aaagttgata aggttataac tttaggaact       540
     ccttactggg gtgctgtaag tgcagcagaa actatgtata ctggagaggt tagtgtactt       600
     ccggatatag taagaggtgc tatgagtggt acaatgagag accttgttac taattaccca       660
     agtatgcatc aactactacc aaatacatat tacacaaata agtcaaattg gttaactact       720
     gaaaaaagag tatatgaaaa gtggtatgat tatgtttggc cgagaacaaa ggatatatta       780
     aataatactg cagatacaca acagttttat aaggataatt ttaattcaag cttagtaaca       840
     gttgcaacga acttccataa tagtttgtat agttctacag caccaattaa attagttgat       900
     aatactgtaa ttgttggaaa tggtgttaat acagtgactt ctgttaaact tgccacaaat       960
     agtattttag gaattaagtc aagattatca gttccaaagt atactactag tggagatggt      1020
     actgttccat ttttaagtgc tactataggc aatggagtaa attacattca aagaaatgga      1080
     atagatcata caggattagt gaaagatcca acaacactta caatggtagt tgatagtata      1140
     agaggtgcta tagcttcaaa ggcttctgta gtgagaagcg cagtaagtgc tcaaggtagc      1200
     cctattgatt ataagcttac ttttgctgga gatttaaatt tccaagctat aaaagataat      1260
     acagttgtat caagtataga taagcttcca atggaggatc aaaattatta caatgtaaaa      1320
     gatgcaaagg aagttaaaat tgataatatc ggtaccgttg gagaagataa tgcatattta      1380
     gcgactttca ctcaagctgg ttataccttt aagtttaaat caaataaaga tcaaaaaatc      1440
     gattttgcag ttggtcctaa taacttaata tttggcttcg ataacataaa tttaaacgaa      1500
     ggtgcagatg tttacgtaaa tatgacttcg caagagaata tcagtgcagc tattgataat      1560
     aatgcagatg gtgttgtaga ttcagttgta aatcctacca ttaaagatct tagcgaagat      1620
     ataactgcca atgatttagt tgtttattca agtgatagga atgcttataa taagttggat      1680
     aattctttat atcctcaaat gaaggttaag aatgtttcga ataagactat caatctttct      1740
     gatttagaac ttagatattt ctttaataat gatggaaatg ataataataa atttgaatgt      1800
     gactgggcag gtttaaacaa tggtactata aatgcttctg tgaaatcaga ttttgttagc      1860
     aatgaaaatg gtgatacaat gcttacgata ggttttgtaa atgacggaaa agtgcttatg      1920
     ccaggacaag aaatagaagt tcaaggaaga atacataatg ataaatggag tatttataac      1980
     aaatctaatg attattcatt tagtggacaa gcatatacag ttaatagcaa ggtggtatta      2040
     tatgctaagg atttgttaat tttcggagtt actccataa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page