(data stored in ACNUC7421 zone)

EMBL: CP002160.PE532

CP002160.PE532       Location/Qualifiers
FT   CDS_pept        complement(680093..680275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0550"
FT                   /product="Bacteriocin class II, amylovorin-like"
FT                   /note="PFAM: Bacteriocin class II, amylovorin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50323"
FT                   /db_xref="GOA:D9SR35"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR35"
FT                   /inference="protein motif:PFAM:PF10439"
FT                   /protein_id="ADL50323.1"
FT                   /translation="MENFVSLTEVELHEIEGGRWSWKKIAKVAFAVIKTATTIASGGAV
FT                   IPAVIKGAITIIPEL"
     atggaaaact ttgtttcatt aacagaagtt gaattacatg aaatcgaagg tggaagatgg        60
     agttggaaaa aaatcgctaa ggttgctttt gcagtaatta aaacagcaac aactatagca       120
     tctggtggtg ctgtaatacc tgctgtaata aaaggagcta ttacgataat tccagaactt       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page