(data stored in ACNUC7421 zone)

EMBL: CP002160.PE534

CP002160.PE534       Location/Qualifiers
FT   CDS_pept        681073..681792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: edi:EDI_341030 intracellular protein transport
FT                   protein USO1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50325"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR37"
FT                   /inference="similar to AA sequence:KEGG:EDI_341030"
FT                   /protein_id="ADL50325.1"
FT                   /translation="MNKILRVIAGVSVAACVLSGCGNDSDSSKKVESSKETSSTTENVN
FT                   NDNKNSAESTKDKNEGLPVVDDSVVREFKQDTPENAIREFYANVSSLNEKEYATFYQVP
FT                   DGYKTIKYSWECYGIEKIDVTKVEVDYNDSVPNDPIALATVQYNQKLKDIEEPLSTFTM
FT                   IELRKVNEKWVIAAQESLTQAQDQWVVKLREEKMNTDEYKKLLESSRKFQEKNSEFMSK
FT                   AAQELNKYLTGQDGTSR"
     gtgaataaga tacttagagt tattgcaggt gtttctgtag cagcatgcgt tcttagtggt        60
     tgtggaaatg attctgatag ttcgaagaag gtcgaaagtt ctaaagaaac atcttcaaca       120
     actgaaaatg tgaataatga taataaaaac tcagctgaat ctactaaaga taagaatgaa       180
     ggattaccag ttgtagatga tagtgttgtt agagaattta agcaagatac gccagaaaat       240
     gctataagag aattttatgc taatgtaagt agtttaaatg aaaaagaata tgcaactttt       300
     tatcaagttc cagatggata caaaaccatt aaatattctt gggaatgtta tggtatagaa       360
     aaaatagatg ttacaaaagt tgaagtagat tataatgatt cagttccgaa tgatcctatt       420
     gcattagcta cagtacaata taatcaaaaa ttgaaggata tagaagaacc attgtcaaca       480
     tttacaatga tagaacttag aaaagtaaat gaaaaatggg ttattgctgc tcaagagtca       540
     cttacgcaag cacaagatca atgggtagtt aagttaagag aagaaaagat gaataccgat       600
     gagtacaaga aacttttaga aagctctagg aagttccaag aaaaaaattc agagtttatg       660
     agtaaggcgg ctcaagaact taacaaatat cttacaggac aagatggaac atcaagataa       720
//

If you have problems or comments...

PBIL Back to PBIL home page