(data stored in ACNUC7421 zone)

EMBL: CP002160.PE535

CP002160.PE535       Location/Qualifiers
FT   CDS_pept        complement(681885..682748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0553"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.29"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; KEGG: cbe:Cbei_1903
FT                   fructose-1,6-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50326"
FT                   /db_xref="GOA:D9SR38"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR38"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ADL50326.1"
FT                   /translation="MLVSAKEMLNAARDGKYAVGQFNINNLEWTKAILLTAQENKSPVI
FT                   LGVSEGAGKYMGGYKTIVGMVNGLLEELNITVPVALHLDHGSYEGCFKAMEAGFSSIMF
FT                   DGSHYPIAENIAKTTELVKITGEKGLSLEAEVGSIGGEEDGVVGTGEVADPAECKSIAD
FT                   LGVTMLAAGIGNIHGKYPANWTGLNFEVLAKIKEATGDMPLVLHGGTGIPESMIKEGIS
FT                   LGVAKINVNTECQLSFAEATRKYIEAGKDLQSKGFDPRKLLAPGFEAIKATVKEKMELF
FT                   GSVNRA"
     atgttagtat cagctaaaga aatgctaaat gcagctagag atggaaaata tgctgtagga        60
     caattcaata tcaataactt agaatggaca aaggcaatat tattaactgc acaagaaaac       120
     aaatcaccag ttatattagg tgtatctgaa ggtgcaggaa aatatatggg tggttataaa       180
     actatagttg gaatggttaa tggtcttctt gaagaattaa acataactgt tccagtagca       240
     ttacatttag atcacggtag ctatgaaggt tgctttaagg ctatggaagc tggattctca       300
     tcaataatgt ttgatggttc tcactaccca atagcagaaa atatagctaa aacaactgaa       360
     ttagtaaaaa tcacaggtga aaaaggtctt tctttagaag ctgaagttgg atcaatcggt       420
     ggagaagaag atggagttgt tggtactggt gaagttgctg atccagcaga atgtaaatca       480
     attgctgact taggagttac tatgttagct gctggtatcg gaaatatcca tggaaaatac       540
     ccagcaaact ggactggatt aaacttcgaa gtattagcaa aaatcaaaga agcaactggc       600
     gatatgccat tagtattaca cggtggtact ggtattcctg aatcaatgat aaaagaaggt       660
     atctctttag gagttgctaa aatcaacgtt aatactgaat gccaattatc ttttgctgaa       720
     gctactagaa aatatataga agctggaaaa gacctacaaa gcaaaggctt tgacccaaga       780
     aaattattag ctccaggttt tgaagctata aaagcaacag ttaaagaaaa aatggaactt       840
     ttcggttctg taaacagagc ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page