(data stored in ACNUC7421 zone)

EMBL: CP002160.PE541

CP002160.PE541       Location/Qualifiers
FT   CDS_pept        complement(687766..688602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0559"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: cpr:CPR_0474 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50332"
FT                   /db_xref="GOA:D9SR44"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR44"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADL50332.1"
FT                   /translation="MMINERYIISESINKENRDLLVYHHGIEQCIPKHCYGPAIRDHYL
FT                   IHYILAGKGKFHANGKIYELVTGDGFLILPDMVTFYEADENEPWTYVWIGFRGIKAAAY
FT                   LESANLNMNNLIFNCTSEILKEYFFKIMNANLYSSGYELRLQGYLSIILSELIDISAMD
FT                   ILDTNKHSDIYVRKALQYIETNYSGSTSVDAVAKAIGLNRNYFSTIFKKHIGISPKEYI
FT                   IRYKIGKACEFLKNNSLTISEISKSVGYNDPLSFSKVFKHIKGVSPKYYRLKKEDT"
     atgatgatta atgagcgtta tattatttct gaatctataa ataaagaaaa tcgagatcta        60
     cttgtatatc atcacggcat agaacaatgt attcctaaac attgctacgg cccagctata       120
     cgagaccact acttaattca ttatattttg gctggtaagg ggaaatttca tgccaacggt       180
     aaaatttacg aattggtcac tggcgatggt tttttgatac tccctgatat ggtaaccttc       240
     tatgaagcag atgaaaacga gccttggact tatgtatgga taggttttag aggtataaaa       300
     gctgctgctt atttagaaag tgctaattta aatatgaaca accttatctt caactgtaca       360
     agtgaaatcc taaaagaata cttctttaag ataatgaatg ctaatctcta ttcttcaggc       420
     tatgaattga gacttcaagg atatctaagt attatattat ctgaacttat agatataagt       480
     gctatggata tcttagatac taataaacat tcagatatct atgtacgtaa agcacttcaa       540
     tacatagaaa caaattattc tggttctact tctgttgacg ctgtagccaa agccatagga       600
     cttaatcgta attattttag taccattttt aaaaaacata ttggtatatc tccaaaagaa       660
     tatattattc gttataagat tggtaaggcc tgtgaattcc taaaaaacaa cagtttgact       720
     attagtgaaa tctccaaatc tgtaggttat aatgaccctt taagtttttc aaaagtattt       780
     aaacatatca aaggtgtttc tcctaaatat tatagattaa aaaaggaaga tacctaa          837
//

If you have problems or comments...

PBIL Back to PBIL home page