(data stored in ACNUC7421 zone)

EMBL: CP002160.PE545

CP002160.PE545       Location/Qualifiers
FT   CDS_pept        703175..703600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50336"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR48"
FT                   /inference="similar to AA sequence:KEGG:HCH_03160"
FT                   /protein_id="ADL50336.1"
FT                   /translation="MSMYEHTYRVFKSSWGISIKITAEITTVGNCDEDSKYDKICDGLM
FT                   AGYASKPLVDGEKFLEEDKIFLWEGLKRVGDLIVNTSPYKADTLIIIHSLVFSLCDFQE
FT                   EGLTAAIIEWAANACGFQAPIINVSFNKELNKYEFKY"
     atgagtatgt acgaacacac ttatcgcgta tttaagtcgt cttgggggat aagcataaaa        60
     ataactgctg aaattacaac agttggtaac tgcgatgaag atagtaaata tgataaaata       120
     tgtgatggtt taatggcagg ttatgcaagt aaacctttag tagatggcga aaagttttta       180
     gaggaagata aaatattcct atgggaaggg ttgaaaagag taggtgattt aatagttaat       240
     acatcaccgt ataaggcaga tacgttaata attatacatt cgctagtttt tagtttatgt       300
     gattttcagg aagaagggtt gactgctgca ataattgaat gggctgcaaa tgcatgtggt       360
     tttcaagcac caattattaa tgtaagtttc aataaagagt taaataaata tgagtttaaa       420
     tattag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page