(data stored in ACNUC7421 zone)

EMBL: CP002160.PE547

CP002160.PE547       Location/Qualifiers
FT   CDS_pept        704979..705362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC0929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50338"
FT                   /db_xref="InterPro:IPR028957"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR50"
FT                   /inference="similar to AA sequence:KEGG:BC0929"
FT                   /protein_id="ADL50338.1"
FT                   /translation="MFEGIDNAVVIKNIFGDKNVFEKAELINVNWQMIDSRIELSILVH
FT                   DEPTKVPKKWGVFESVYVRLEFYGLNYLRIDVKEDKPRIEKFTMQSNSDKYCCKISMSD
FT                   EQEIQCTFEVARIQNIKPFVDKQ"
     atgtttgaag gaattgataa tgcagttgta attaagaata tttttggtga caaaaatgta        60
     tttgaaaaag ctgaactaat taatgtaaat tggcaaatga ttgattctag aattgagtta       120
     tcaatattag ttcatgatga gccaacaaag gttcctaaaa aatggggggt ctttgaaagt       180
     gtctatgtaa ggctagagtt ttatggcttg aactatttaa gaatagatgt aaaagaagat       240
     aagccaagaa tcgagaagtt tacgatgcag agcaatagcg ataagtactg ttgcaaaata       300
     tctatgagtg atgagcagga aattcagtgt acgtttgaag tggctcgtat tcaaaatatt       360
     aaaccgtttg tagataagca gtaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page