(data stored in ACNUC7421 zone)

EMBL: CP002160.PE550

CP002160.PE550       Location/Qualifiers
FT   CDS_pept        complement(707158..709572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0570"
FT                   /product="cellulosome anchoring protein cohesin region"
FT                   /note="PFAM: cellulosome anchoring protein cohesin region;
FT                   KEGG: pjd:Pjdr2_3202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50341"
FT                   /db_xref="GOA:D9SR53"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR53"
FT                   /inference="protein motif:PFAM:PF00963"
FT                   /protein_id="ADL50341.1"
FT                   /translation="MKISCDLRFKKIFSVLCICILFLGFSLTSIPVSAATETTVSYSIT
FT                   GDGIVGSTVEIAANVSSASNLYGVSWDFIYDTSMLQIQSISAGPLMGTNISKFTSNANG
FT                   RAYISMSKFTTASPVNGEGTLAIIRARVLKVGTIKINTTPTTSNLNISNLTSCIKLSDD
FT                   YSNKIAYSYKDSSIITKPISSLTDGKYENTNGNLTYTDNWIKATDSSQHFSNVLDNEVS
FT                   FSFEGTGVNIHSITANNRGIAKVYIDGIAYDADDYTETVQRKVIFSKTDLPIGKHEVRI
FT                   VVTNNKNAASTGYYISIDAIEILCNPPVLKSGKYQNTDSNLFYAGSWVQVTDGSQRYSK
FT                   IENSTLYFSFEGTGFNLTSLVASNRGIAKIYVDGTAYDIDTYSPTVTSKIIFAKDGLPF
FT                   GKHDVKVVVTNTKNATSTDTYISIAAIEILISPPVLTTGKYENTNSNLIYTGSWVQVAD
FT                   GSQRYSNIVDSAFQFSFEGTGFNLNSLVANNRGIAKVYIDGTSYDVDTYSDVVQRKTIF
FT                   SKDGLAMGKHTVKVVITNTKNAASSNYYISITSIEILNSSPVLASGMYENTSSDIAYTG
FT                   SWVKVTDGSQNYSKIENSALYFSFQGTGFNLHSIVANNRGIAKVYVDGVAYDVDTYSPT
FT                   VERKIVFTKDGLAYGKHNVKILVTNTKNTTSTDTYISIDAVEILVTPPTLSSGKYDNFD
FT                   PNLIYTGSWTSVAYDSQHFSKTENSTVSFSFEGTGFNLHSLVASNRGIAKLYVDGVAYD
FT                   VDTYSPTIERKIVFTKDGLTYGKHNVQIVVTCTKNTISTDTYISIDAVEII"
     atgaaaatct cctgtgatct aagatttaaa aaaatattct ctgtcttatg catttgtatt        60
     cttttcttag gattttcctt aacatcaatt ccagtatctg cagctactga aaccacagtt       120
     agctatagta taactggtga tggtattgta ggcagtacag tagaaattgc tgctaatgta       180
     tcatcagcta gtaatttata tggagtttct tgggatttta tatatgatac tagcatgtta       240
     caaatacaaa gcatatccgc gggtccttta atgggcacaa atatatcaaa atttacatca       300
     aatgcaaatg gacgtgccta tataagtatg tctaagttta ctactgcatc tcctgtaaat       360
     ggtgaaggta ctcttgctat tataagagca cgagttctta aagtaggcac tattaagatt       420
     aatacaacac caactactag caatcttaat atttcaaatc ttacttcttg tataaaactc       480
     tctgatgact atagtaataa gattgcttat agctataaag atagttctat aattacaaaa       540
     cctataagtt cacttacaga tggaaaatat gaaaatacta atggaaacct tacttatact       600
     gacaactgga taaaagcaac tgatagttct caacattttt caaatgtttt agataatgaa       660
     gttagttttt cttttgaagg aacaggcgta aatattcact ctataactgc aaataataga       720
     ggtattgcta aagtatatat tgatggcata gcctatgatg ctgatgatta tacagaaaca       780
     gttcaaagaa aggtgatttt ctctaaaact gatttgccaa ttggtaagca tgaagttaga       840
     attgtagtta ctaataataa aaatgctgct tcaactggat actatatctc catagatgct       900
     attgaaattc tatgtaaccc tccagtttta aaatctggta aatatcaaaa tactgattca       960
     aacttatttt atgctggttc ctgggtacaa gtcactgatg gttctcaacg ctattctaaa      1020
     atagaaaata gcaccttata tttttctttt gagggaactg gtttcaacct tacctcactt      1080
     gtcgcaagca ataggggtat tgctaaaata tacgtagacg gaactgctta tgatattgac      1140
     acttattcac ctacagttac atctaaaatc atttttgcca aagatggatt acctttcggt      1200
     aaacatgatg taaaagtagt agttactaat acaaagaatg cgacatcaac tgatacttat      1260
     atttctatcg ctgctataga aatattgatt tcaccaccag ttcttacaac tggtaaatat      1320
     gaaaatacaa attcaaattt aatttacact ggttcttggg tacaagtcgc tgatggttct      1380
     caacgctatt caaatatagt agacagtgct tttcagttct ccttcgaagg aaccggcttt      1440
     aatctaaatt ctcttgttgc taacaacaga ggaatagcta aagtatatat tgatggaaca      1500
     tcctatgatg ttgatactta ttcagatgtt gtccaaagaa aaactatctt ttccaaagat      1560
     ggtttggcca tgggcaaaca tactgtaaag gtagtgatta ctaatactaa aaatgcagca      1620
     tcatcaaact attatatttc cattacctct attgaaattt taaattcatc tccagttctt      1680
     gcatctggaa tgtatgaaaa tacttctagt gatatagcat atactggttc ttgggtaaaa      1740
     gtaacagatg gttctcaaaa ttactcaaag attgagaata gtgctttata tttctcattc      1800
     caaggaacag gctttaatct tcattcaata gttgctaaca atagaggtat cgccaaagta      1860
     tatgtagatg gagtagccta tgatgtagac acttactcac ctacagttga aagaaaaatt      1920
     gttttcacaa aggatggatt agcctacgga aaacataatg tgaaaatatt agtaacaaat      1980
     acaaaaaata caacatcaac tgatacttat atttctattg atgctgttga aatcctagta      2040
     acaccaccta cactttcctc tggaaagtat gataactttg atccaaacct aatttatact      2100
     ggttcttgga caagtgttgc ttatgattct caacattttt caaaaactga aaatagtact      2160
     gtgagttttt cattcgaagg aacaggtttt aaccttcact cactagttgc tagcaataga      2220
     ggtattgcca aattatatgt agatggagta gcctatgatg tagacactta ctcgcctaca      2280
     attgaaagaa aaattgtttt cactaaggat ggattaacct acggaaaaca taatgtacaa      2340
     atcgtagtaa cctgtacaaa aaatacaata tcaactgata cttatatttc tattgatgct      2400
     gttgaaatta tataa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page