(data stored in ACNUC7421 zone)

EMBL: CP002160.PE551

CP002160.PE551       Location/Qualifiers
FT   CDS_pept        complement(709785..710927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0571"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: cbe:Cbei_1821 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50342"
FT                   /db_xref="GOA:D9SR54"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR54"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADL50342.1"
FT                   /translation="MNNSFIDLKINQNLIEGLEKQNITIPTEIQQLVIKSALENKDIIG
FT                   ESYTGSGKTLSYLLPIFHKIDTAKREMQAIILAPTHELVMQIEEQVSLLAKNSEIPVTS
FT                   LTIIGEASMEKQIKKLKDNKPHIIVGTIGRVLDLIQKKKIKAHTVKTIVIDEADNLLSE
FT                   SSLGTVNNIIKTTMRDRQLMAFSATINPKTLDTAKALMKEPEVFKTDGKVAMNPRISHE
FT                   YIVCSHRDKFEILRKLIAATKTERAIVFLNKNEEIQLITDKLNYHSKNAGGIYGAASKE
FT                   ERKNTINSFKSGKINLLVSSDLSARGLDVPEVTHIFNLDFPVNTNDYSHRAGRTARGNL
FT                   SGTCISIITEKELAAIRVYEREFNVKFEQIDVYEGRIHKA"
     atgaacaatt cttttattga cttaaagata aatcaaaatc ttatagaagg tttggaaaaa        60
     caaaacataa ctataccaac agaaatccag cagctagtga taaaatcagc tttagaaaac       120
     aaagatatca taggtgaatc ttatactggt agcgggaaaa ctttaagcta tcttcttcct       180
     atctttcata agatagatac tgcaaaaaga gaaatgcaag caataattct tgcaccaact       240
     catgaactag taatgcaaat tgaggagcaa gtttcgttac tagctaagaa ttcagaaatt       300
     cctgtaactt ctcttactat aattggtgag gcaagtatgg aaaagcaaat aaaaaagctt       360
     aaggataaca aacctcatat tatagtagga acaatcggaa gagttttaga tttaattcaa       420
     aagaaaaaga ttaaagctca cactgtaaag actattgtca ttgatgaagc tgataattta       480
     ctttctgaaa gtagccttgg aactgttaat aacatcatta aaacaactat gagagataga       540
     caactaatgg cattctcagc tacaataaat cctaaaactt tagatactgc aaaagcatta       600
     atgaaggagc cagaagtatt taagacagat ggtaaggtag caatgaatcc tagaatttct       660
     catgagtata tagtatgctc tcatcgtgat aagtttgaaa tcttaaggaa acttattgca       720
     gctactaaaa cagaaagagc catagtattt ttaaataaaa atgaagaaat tcaacttata       780
     acagataaat taaattatca cagcaaaaat gccggcggta tttacggcgc tgcttcaaag       840
     gaagaaagaa aaaacactat aaattctttt aaaagcggaa agataaattt attagtatcc       900
     tctgatttat cagctagagg tcttgatgtg ccagaagtta ctcatatctt caatcttgat       960
     tttcctgtga ataccaatga ttattcccat agggcaggaa gaacggcaag aggaaatctt      1020
     tctgggacct gtatttctat aatcacagaa aaagaactag cagcaatacg agtttatgag      1080
     agagaattta atgttaaatt tgaacaaata gatgtttatg aaggaagaat ccataaagct      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page