(data stored in ACNUC7421 zone)

EMBL: CP002160.PE552

CP002160.PE552       Location/Qualifiers
FT   CDS_pept        711114..711827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0572"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG:
FT                   bay:RBAM_006580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50343"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR55"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADL50343.1"
FT                   /translation="MGVLGRFKAIMEANINALLDKAEDPSKMIDQYLRDLNSDLGKVKA
FT                   ETAAIMAEEQRTKRVYEECGVEIEKMQNYAKKAVQAGNDNDARQFLGKKAELLQKQESL
FT                   KMAYDAAKANAIKMKSMHDKLQRDIGQLNARKDAIKAKVSIAKTQERINKMGASITNAG
FT                   ANISAFDRMEEKADRMLDEANAMAELNKSSEEVDINLLTSKYDSSINIEDELEMLKGND
FT                   IEEELKALKENSTQD"
     atgggagtac taggacgttt caaggcaatt atggaagcta atattaatgc gttactagat        60
     aaagcagaag atccgagtaa aatgatagac caatatctta gggatttaaa tagcgattta       120
     ggaaaagtaa aggctgaaac agcagcaata atggctgaag aacaacgtac aaagcgtgtt       180
     tatgaagagt gtggtgttga aatagagaag atgcagaatt atgcaaaaaa ggctgtacaa       240
     gcaggaaatg ataatgatgc tcggcagttt ttagggaaga aggcagagct tcttcaaaag       300
     caagaaagcc taaaaatggc gtatgatgca gctaaagcta atgcaattaa aatgaaatct       360
     atgcacgata aacttcagag agatataggt cagttaaatg ctcgaaaaga tgcgattaaa       420
     gcaaaggtgt caatagctaa aactcaagag agaattaaca agatgggtgc ttctattacc       480
     aatgcaggag caaatatatc tgcatttgac agaatggaag agaaggctga tcggatgtta       540
     gacgaagcga atgctatggc agagcttaac aaatcttctg aagaagttga tataaatcta       600
     ttaacaagca aatatgattc atcaataaat attgaagatg agctagaaat gcttaaagga       660
     aatgatatag aggaagagct taaagcttta aaagaaaata gtacccaaga ttag             714
//

If you have problems or comments...

PBIL Back to PBIL home page