(data stored in ACNUC7421 zone)

EMBL: CP002160.PE553

CP002160.PE553       Location/Qualifiers
FT   CDS_pept        711918..713126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lba:Lebu_1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50344"
FT                   /db_xref="GOA:D9SR56"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR56"
FT                   /inference="similar to AA sequence:KEGG:Lebu_1615"
FT                   /protein_id="ADL50344.1"
FT                   /translation="MDKESYKCECCGGTMEFDVKTQKLKCPNCDNMIEIIDNKNFVIEH
FT                   KFTLIDRETIKVSMKNSSTMECQGCGAHVEVASDCTAVSCPYCGSSYVLAEKQEEILIP
FT                   DGVIPFKVEKAEIAQMMRKWIYSRWLAPNKLKALYENDKIQGIYVPYWTFDAMVDCPYT
FT                   AMGGRDRQVAYQDREGKVHYRTETDWFFTKGRINYFFDDVQVTASRNMNPSLINGIEPF
FT                   TTKDIASYSPSYLSGFSAETYSIGLEEGNIEAKKKMRNELHRMAEKEVTRHYDRVREVR
FT                   LNPSFYDETYKHVLLPVYATSYSYNGKNYHVLINGETGKMKGDYPKSPFKIAILVIFAM
FT                   IIAAIILYLKNHSEIRKVSFNNNIYQTQLSNSQNIFNNIYEEVNKFNNQEVYIHGVIFK
FT                   SVL"
     atggacaaag agagttataa gtgtgaatgt tgtggtggaa ctatggagtt tgatgtgaaa        60
     actcaaaaat tgaaatgtcc taattgcgat aacatgatag agattataga taataaaaat       120
     ttcgttattg aacataagtt tacattgata gatagagaaa ctataaaggt atccatgaaa       180
     aactcaagta ctatggaatg tcaggggtgt ggggcacatg tggaagtagc ttccgattgt       240
     acagctgttt cttgtccata ctgtggttca agttatgtat tagcagaaaa acaagaggag       300
     attctaattc ctgatggagt tattcctttt aaagttgaaa aagctgaaat agcccagatg       360
     atgaggaagt ggatttatag tagatggctt gctccaaaca agttaaaagc tctatatgaa       420
     aatgataaga ttcagggtat atatgtacct tattggactt ttgatgcaat ggtagattgc       480
     ccatatacag ctatgggtgg tcgtgataga caagtagcat atcaagatag agaaggtaaa       540
     gtacactaca gaacagaaac agactggttt tttacaaagg gaaggataaa ttatttcttt       600
     gatgatgttc aagtaactgc ttcaagaaat atgaatccct cgctaataaa tggtatagaa       660
     ccatttacta caaaagatat agcatcatat tctccaagct atttatctgg cttttccgct       720
     gaaacttaca gcataggttt agaggaggga aatattgagg caaagaagaa aatgagaaat       780
     gaattacatc gcatggcaga aaaagaggta acaaggcatt atgatagggt gagagaggta       840
     aggttaaatc caagcttcta tgatgaaacc tataagcatg tattattacc tgtttatgct       900
     acttcctata gttataatgg aaagaattat catgtactta taaatgggga aactggaaag       960
     atgaaaggtg attatcctaa gagtccattt aaaatagcta tattagtcat ctttgcgatg      1020
     ataattgcag ctattatcct atatctaaaa aaccattccg aaatcagaaa agtgagtttt      1080
     aacaataata tatatcaaac acaactttct aatagtcaaa atatttttaa taatatatat      1140
     gaggaagtga ataaattcaa taatcaggag gtgtatattc atggggttat tttcaagtca      1200
     gttctctaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page