(data stored in ACNUC7421 zone)

EMBL: CP002160.PE554

CP002160.PE554       Location/Qualifiers
FT   CDS_pept        713098..714069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0574"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: bld:BLi00643 YdjI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50345"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR57"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADL50345.1"
FT                   /translation="MGLFSSQFSNVVEWEEYRDDLIFWKWSNKEIKKGSRLIIRQGQDA
FT                   IFMYNGKLEGIFTDEGSYDMESQIVPFLSTLKGFKFGFNSGIRAEVLFINTKEFTVKWG
FT                   TKNPVSIEAPGLPGGMPIRTFGTFNFKVADYMVLIEKIAGIKKQYAVEDIKERVTSILN
FT                   QLLMKWIAKEGKNKFNLQANAFDIAKGIREDLDMEIIKLGITVTGFNIESFTYPEEVEK
FT                   MATKVASHSMINDMGKYQNVSIVDGMASGNMKGGGTASDVMGIQMGYMMGKQVVDQMQQ
FT                   NKNVNNVASQETTTSAAPKFCPNCGVKTQGTKFCSNCGYKLI"
     atggggttat tttcaagtca gttctctaat gtagtagaat gggaagaata cagagatgat        60
     cttatatttt ggaaatggag taataaggag ataaagaagg gtagtcgtct tattatacgc       120
     caagggcaag atgctatatt tatgtacaat ggaaaattag aaggaatatt tactgacgaa       180
     ggtagttatg acatggaatc tcaaattgta ccttttcttt caactttaaa aggctttaaa       240
     tttggtttta atagtggaat tagagctgaa gttttattta taaacacaaa agaatttact       300
     gtgaaatggg gaacaaaaaa tcctgtaagt attgaagcac caggacttcc tggagggatg       360
     cctataagaa cttttggaac cttcaatttt aaggtcgctg attatatggt attgattgaa       420
     aaaattgcag gaataaaaaa gcaatatgca gttgaggata ttaaagaacg tgtaacatct       480
     atattgaatc aattgctgat gaagtggatt gcaaaagaag gcaaaaataa atttaatctt       540
     caagcaaatg catttgatat agctaaggga ataagagaag atttagatat ggaaataatt       600
     aagcttggga taacagttac tggttttaat attgagagct ttacttatcc agaagaagta       660
     gagaaaatgg caacaaaagt cgcatcacac agcatgatta atgatatggg caaatatcaa       720
     aatgttagta ttgtagatgg aatggcatcg ggaaatatga aaggtggagg aacggcatct       780
     gatgtgatgg ggattcagat gggttatatg atgggaaagc aagtggttga ccaaatgcaa       840
     caaaataaaa atgtaaataa tgtagcatca caagagacaa caacttctgc agcacctaaa       900
     ttctgcccaa attgcggagt aaaaacccaa ggaacaaaat tttgttctaa ctgtggatat       960
     aagcttattt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page