(data stored in ACNUC7421 zone)

EMBL: CP002160.PE555

CP002160.PE555       Location/Qualifiers
FT   CDS_pept        714431..716131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0575"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: afl:Aflv_1304 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50346"
FT                   /db_xref="GOA:D9SR58"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR58"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50346.1"
FT                   /translation="MKNLRLKGRIVRLLILSVICISSSLLGLSYYFTNKATQSSVTDEL
FT                   TSTSNLVSAVLDSSYPGTWALNGEKLTKGKNPLHDIVGIIDKVKEQSNSEVTIFANDTR
FT                   FITTLIVDNKRNVGTKADEKVIEIVLKNGEEFQSQVTISGVKYIGKYTPIKNGKNEIVG
FT                   MIFVGKEYAVLMKPLTESIVYMVGCTIIVAILMIILGGVFASRVAKPISISVKALKRVS
FT                   SGDLTEDIPSNLSIRKDEAAELAEAVGDMQNFLNNIVNNIKSTTSNMFNSSSNLLTVSE
FT                   NMTAASSNITHAIGEMASGTVGQAEDISDISQSLNEFGNKIQEAKEATSMIHDGSIEIE
FT                   KMTNENNVQMKMVVDSIGNVKEQFDEFANSVSILGSNITRVDEITGVINSIADQTNLLA
FT                   LNAAIEAARAGESGKGFAVVADEIRKLAEESRKSSESIKELVAFIAKDTYKIVDNSKEV
FT                   NNKLAEQLEAINKTLGSFEGITKSVSDIIPKINQVDKNSESINESKTTLISKAENAASI
FT                   AEEISAATEEIAASSEEMASSAIEVEKVSEVLNLETKKLIDYVSIFKSK"
     atgaaaaatt taagattaaa aggtaggatt gttagattat taattttatc agttatttgt        60
     atcagcagtt cgttattagg attatcttat tattttacaa acaaggcaac tcaatcaagt       120
     gtcactgatg aacttacaag tacttctaat ttggtttctg cagttttaga tagtagttat       180
     ccaggaactt gggctttaaa tggtgaaaag ctaacaaaag gaaaaaatcc tttacatgac       240
     attgttggaa taattgataa agtaaaggaa caatctaatt ctgaagtaac tatatttgcc       300
     aatgatacaa gatttataac tacattaatt gtggacaata agaggaatgt tggcactaaa       360
     gcagatgaga aggttataga aatagttcta aaaaatggag aagaatttca aagtcaggtt       420
     acaatttcag gagtgaaata tataggaaaa tatactccta taaaaaatgg aaaaaatgaa       480
     atagtaggta tgatatttgt aggaaaagaa tatgcagtcc ttatgaagcc tctaacagaa       540
     tcaatagtat atatggtggg ttgtacaata atcgttgcaa tattaatgat tatattagga       600
     ggagtttttg ctagcagagt tgcaaaacca atatctattt cagtaaaagc tctaaaaaga       660
     gtatcctctg gagatcttac agaagatatt ccaagtaatt tatctataag aaaagatgaa       720
     gctgcagaat tagcagaagc tgtgggagat atgcaaaact tcttaaataa cattgtgaat       780
     aatataaaga gtactactag caatatgttt aatagttcaa gtaatctttt aactgtatca       840
     gagaatatga ctgctgcatc ttctaatata actcatgcta ttggagagat ggcatctgga       900
     acggttggac aagcagaaga tatatctgat atatcacaaa gtcttaatga gttcggaaac       960
     aaaattcaag aagctaaaga agcaactagc atgatacatg atggttctat agaaattgaa      1020
     aaaatgacta atgaaaataa tgtacaaatg aaaatggtag ttgattctat tggaaatgtt      1080
     aaagaacaat ttgatgaatt tgcaaatagt gtttctatac taggtagcaa tataacaaga      1140
     gttgatgaga taactggagt tataaatagc attgcagatc aaacaaattt attagctctt      1200
     aacgcagcta tagaggcagc aagagctgga gagagtggaa aaggttttgc agttgttgcg      1260
     gatgaaataa gaaaacttgc tgaagaaagt aggaaatcat ctgaatcaat taaggaatta      1320
     gtagcattta tagctaagga tacttataaa atagtagata actctaagga agttaataat      1380
     aagcttgcag aacaattaga ggctataaat aaaaccttag gttcttttga gggaataacg      1440
     aaatctgtat cagacataat accaaaaata aatcaagttg ataaaaattc agaaagtatt      1500
     aatgagagca aaacaacact tataagtaaa gctgaaaatg ctgcgtccat agcagaagaa      1560
     atatcagctg ctacagaaga aatagctgca tcttcagagg aaatggctag ttcagctata      1620
     gaagttgaga aggtttcaga agttttaaat ttagaaacta aaaaattaat agattatgtt      1680
     tcaattttta aatctaaata a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page