(data stored in ACNUC7421 zone)

EMBL: CP002160.PE556

CP002160.PE556       Location/Qualifiers
FT   CDS_pept        716339..718042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0576"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: afl:Aflv_1304 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50347"
FT                   /db_xref="GOA:D9SR59"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR59"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50347.1"
FT                   /translation="MKGFKMRGKILILVIALILSTGITSLVIGYSSSSSLAKDGIYEEL
FT                   TSVEKMTVSLINEKYPGDWKLDGNKLYKGDNLINEDNEFVDFVKEQTNCEITIFRKDTR
FT                   IVTTISEDGKRIVGTTAKENVVSTVIDNKKDYQGNVEISGEPFLVKYSPIVDSKGNAIG
FT                   MVFIGKENSDVRSMINSSIALMLIATVVISILAYILSAIIVKKIINPIIISIECLKKVA
FT                   NGDLTLDIPEDLTVRHDEAGELAKAVQNMQKSLKAIVTNIKKVTGEVYENSENLLAISE
FT                   EMSATSDNISHAVQEMASGSTSQAQDLSTVTEALNDFGDKIEDTKESVSVIYNGSVEIG
FT                   NMTSSSNEDMKNVVNSINSVKSEFDGFTHKIQGLGDNIKRINEITEAINSIAQQTNLLA
FT                   LNAAIEAARAGESGRGFAVVAEEIRKLAEQSSESSDNIKALVESISKDADNIVHSSTIV
FT                   NDQLTEQLDVIDNTIVSFKKITKSIESIIPKMNGVNKATNDINESKDGILGKAENTAAI
FT                   AEEISASSEEIAASTQEMNNAACQVAKSAEELTLQTKRLIEEIEVFKVEK"
     atgaagggtt ttaaaatgag gggaaaaata ttaatattgg taatagcctt aattctatct        60
     actggtataa catcactagt aattggatat tcatcatcta gctcattagc caaagatggt       120
     atttatgaag aacttacatc tgttgagaag atgactgtat cattaataaa tgaaaaatat       180
     ccaggagatt ggaagttgga tggtaataaa ctatataaag gtgataactt aattaatgaa       240
     gataatgaat ttgttgactt tgttaaggaa cagactaatt gtgagataac tatatttaga       300
     aaagatacaa gaatagtaac aacaatttct gaagatggga agaggatagt aggaactact       360
     gctaaggaaa atgtagtttc aactgttata gacaataaaa aggattacca aggaaatgtt       420
     gagatttctg gtgaaccctt tttagttaaa tattcaccta ttgtagattc aaagggaaat       480
     gcaataggta tggtgtttat aggaaaagaa aattctgatg tgagaagtat gataaatagt       540
     tctatagcgc ttatgcttat agctactgtt gttataagta ttttagctta tatattatct       600
     gcaattatag ttaagaaaat aataaatcca ataatcatat ctatagagtg cctaaagaaa       660
     gttgctaatg gagatttaac tttagatata cctgaagatc taacggtaag acacgatgaa       720
     gcaggtgaat tagcaaaagc agttcaaaat atgcagaaat cattaaaagc tatcgtaacg       780
     aacataaaaa aagtaactgg tgaagtatat gaaaactcag agaatctttt agcgatttca       840
     gaagaaatgt cagcaacctc tgataatata tctcatgctg ttcaagaaat ggcatcagga       900
     tctacatccc aagctcaaga tttatctaca gtcacagagg cattaaatga ttttggggat       960
     aaaattgagg atactaagga gtcagtaagt gtaatttata atggatctgt agagatagga      1020
     aatatgactt cttcaagtaa tgaagatatg aaaaatgtag ttaactcaat taattcagta      1080
     aaatcagagt ttgatggatt tacacataaa atccaggggc taggggataa cataaagaga      1140
     attaatgaaa taactgaagc tattaacagc atagcgcaac aaacaaatct tttagccttg      1200
     aatgcagcta tagaagcagc aagagctggt gaaagtggaa gaggttttgc tgttgttgcg      1260
     gaagaaataa gaaaactagc agagcaaagc agtgaatctt cagataacat aaaagcatta      1320
     gtagagtcta tctctaaaga tgcggacaac atagtacata gttctacaat tgtaaatgat      1380
     cagttaacag agcaacttga tgtgattgat aatacaatag tatcctttaa gaaaataact      1440
     aaatccatag aatctataat acctaaaatg aatggtgtta ataaggcgac aaatgatata      1500
     aatgaaagca aggatggaat attaggaaaa gcagaaaata ctgctgctat tgctgaggaa      1560
     atatcagcat cttcagagga aattgcggct tcaactcaag agatgaataa tgcggcttgt      1620
     caggtggcaa aatctgctga ggagttgaca cttcagacaa aaagacttat tgaagaaatc      1680
     gaagtattta aagtggagaa atag                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page