(data stored in ACNUC7421 zone)

EMBL: CP002160.PE557

CP002160.PE557       Location/Qualifiers
FT   CDS_pept        718270..718965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0577"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbb:CLD_1399 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50348"
FT                   /db_xref="GOA:D9SR60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR60"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50348.1"
FT                   /translation="MLKVTNLTKKYGKMLAVKNVSFFVETGEIAVLAGPNGAGKSTVIK
FT                   SIVGLLRYQGSITVNDKINKSIEGKSYIGYIPEIPSLFPLLTVSEHITLMAHAFGIKDY
FT                   ETEAEELLKAFDLWDKKDKFGSELSKGMQQKVSICCAIITKPKILLVDEPMVGLDPKAI
FT                   RTMKNLLLKLKEQGTSIVVSTHLLDSVQDLWDRIIIMKDGEFVYSNTKHEIGKEDKSLE
FT                   DIFFEYTEE"
     atgttaaagg ttacgaactt aactaagaaa tatggaaaaa tgttagctgt taaaaatgta        60
     agttttttcg ttgaaactgg agagattgct gtacttgctg ggcctaatgg tgcaggaaag       120
     tctacagtta ttaagtcaat tgtcggcctt ttaagatacc aaggaagtat aactgttaat       180
     gataagatta ataagagtat tgaaggtaag agttatatag gttatattcc agaaatccct       240
     tccttatttc cgttgcttac agttagcgaa catataacac ttatggcaca tgcttttgga       300
     ataaaagatt atgaaaccga agcagaagaa cttttgaaag cctttgatct ttgggataag       360
     aaggataagt ttggtagtga actttccaaa ggtatgcaac aaaaggtaag tatttgttgt       420
     gcaattataa ctaagccaaa gatactttta gtagatgaac caatggttgg tctagatcca       480
     aaagcaatta gaactatgaa aaatcttctt cttaagttaa aagaacaagg cacatctata       540
     gttgtcagca ctcatcttct agattcagtt caagatcttt gggatagaat tatcataatg       600
     aaagatggag aatttgttta ttctaatact aagcatgaaa taggcaagga agataaatct       660
     cttgaggaca tattctttga atatacggag gaataa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page