(data stored in ACNUC7421 zone)

EMBL: CP002160.PE558

CP002160.PE558       Location/Qualifiers
FT   CDS_pept        718969..720552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50349"
FT                   /db_xref="GOA:D9SR61"
FT                   /db_xref="InterPro:IPR031584"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR61"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_1192"
FT                   /protein_id="ADL50349.1"
FT                   /translation="MKALIYLMKTNIINYFKQLKKKPAKAIGPIAMVVFMITMFLSKND
FT                   TSKTLDIDIFISLFLLITISAFIYSLYTGTKSINSKFNMADVNLIFVSPIKPQTVMIYG
FT                   IIKKMSVELFAYFYIIYQIPNLTKSMDITIGQTVSVIIIFIIMQIVFCNIVKLLVFVLN
FT                   SKYPLLGRIIRLTIKIVGAVLCVAAVLIFLKGRPITFVKELYSSIGQDSWIKFIPIFGW
FT                   VREMVYQSLTTINMTFFLYLAMIIFLSVLLVYITYCIEIDFYEDMLSSAEANEVIKKAK
FT                   NREQVTTESNRNNRLFKAFRKVQLKLDNKYKAEVLFYKHLNEYSKRSFLFFINTYSIIL
FT                   LLVSLTLGIFAKGVEIKLVYMIFCGLLFFGAGLAGKIYYEITNPLIFMIPDSPQKKLFY
FT                   GTASSLIKLVSDSIILFIPFGILSGVSIIEMFLCCISYVLLGAMFSYSGLVGFRISNYF
FT                   GFTDQISQGVFFMFFQMFLLVPAAIMVITLGVATEFSGYAIYLAMIAYTSVLTVIFSFG
FT                   AVGIFDNMEL"
     atgaaagctc ttatatattt aatgaaaaca aatatcataa attattttaa gcagcttaag        60
     aaaaagcctg ctaaggcaat tggacctatc gcgatggttg tatttatgat aactatgttc       120
     ctttcaaaaa atgatacttc taaaaccttg gatatagata tatttataag cttatttctt       180
     ttgataacca taagtgcgtt tatttattcc ttatatactg gaactaagag tataaattca       240
     aagtttaata tggctgatgt aaatcttata tttgtttcac ctataaaacc tcagacagtt       300
     atgatttatg gaataataaa aaagatgtct gtagagttgt ttgcttattt ttatataata       360
     tatcaaattc ctaatttgac taaatctatg gatattacta tagggcaaac tgtatctgta       420
     ataataattt ttattatcat gcaaattgta ttttgtaaca tagtaaaact cttagtgttt       480
     gtattaaatt caaaatatcc attgctagga aggataattc gtttaacaat aaaaattgta       540
     ggtgctgtac tgtgtgtagc agcagtgtta attttcttga aaggcagacc tataaccttt       600
     gtaaaggaat tgtatagttc tataggacag gattcatgga ttaagttcat tcctatattt       660
     ggatgggtaa gagaaatggt ttatcaaagc cttacaacga taaatatgac ctttttctta       720
     taccttgcga tgattatatt tttaagtgtt ctgttagtat acataacata ttgtatagag       780
     attgactttt atgaagatat gttatcatca gctgaagcca atgaagtgat taagaaggct       840
     aaaaatagag aacaggttac tacagagtca aatagaaata ataggctatt taaagctttt       900
     agaaaagttc aattaaaatt agataacaag tataaagcgg aagttttatt ttataagcat       960
     ttaaatgaat attcaaaaag aagtttttta ttttttatta atacgtactc cattatatta      1020
     ttattagtat cgcttacctt ggggattttt gcaaagggag tagaaataaa acttgtttat      1080
     atgattttct gtggcttact tttctttgga gcaggtcttg cagggaagat atattatgag      1140
     ataacaaatc cacttatttt tatgattcca gattcaccac agaagaaatt gttttatgga      1200
     acagcttctt ctttaataaa acttgtttct gacagcataa tattatttat tccctttggt      1260
     attttaagtg gtgtatcaat aattgaaatg tttctgtgtt gcataagcta tgtgctttta      1320
     ggagcaatgt tttcttacag tggacttgtt ggttttagaa tctcaaatta ctttggattt      1380
     acagatcaaa tatcacaagg tgtatttttt atgttttttc agatgttttt attggttcca      1440
     gctgctataa tggtgataac cttaggggtt gccacagaat tcagtggtta tgcaatatat      1500
     ttagcaatga tagcctatac ttcagtatta acagtaatat tttcctttgg tgctgtagga      1560
     atttttgata atatggaact atag                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page