(data stored in ACNUC7421 zone)

EMBL: CP002160.PE560

CP002160.PE560       Location/Qualifiers
FT   CDS_pept        complement(720971..721594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfh:PFHG_05374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50351"
FT                   /db_xref="InterPro:IPR032256"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR63"
FT                   /inference="similar to AA sequence:KEGG:PFHG_05374"
FT                   /protein_id="ADL50351.1"
FT                   /translation="MLNNKKSLLSIFLVIALFTGAGCSKTEKPVKESSTANSSLSDGTS
FT                   NVSASYELEYHNDTRFFKAEIEPKSDAEKVILDKFKIQINDKYDELSKLFIDSPEFNNQ
FT                   SQIYKNLFDEGEYAEAITIHSLKKLSEEEYSNNPDFISYNFMDTINKFNPYEFQVIEVN
FT                   YTIKLTDKYASAAQWSNGNWTRDFIVVQEKENTPWRIFDIYGYH"
     ttgctaaaca ataagaaaag cttattatct atatttctag tcatagcttt atttactgga        60
     gctggatgct caaaaacaga aaaacctgtg aaagaatctt ctactgcaaa tagttctcta       120
     agtgatggta cttcaaatgt atcagcatct tatgaactag agtatcataa tgacacaaga       180
     tttttcaaag cagaaataga accaaaatct gatgcagaaa aagttattct tgataaattt       240
     aaaattcaaa taaatgataa gtatgatgaa cttagtaagt tatttataga tagcccagaa       300
     ttcaataacc aatcacagat ttacaaaaac ctctttgatg aaggagaata tgctgaagca       360
     ataacaatac acagtttaaa aaagctaagt gaagaagaat actctaacaa ccctgatttt       420
     atttcatata attttatgga tacaattaac aagtttaacc cctatgaatt tcaagtgata       480
     gaagtcaact atacaattaa gcttacagat aaatatgcct cagcagcgca atggagtaat       540
     gggaattgga caagagattt tatagttgta caggaaaagg aaaatacacc ttggagaata       600
     tttgacatct atggttatca ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page