(data stored in ACNUC7421 zone)

EMBL: CP002160.PE561

CP002160.PE561       Location/Qualifiers
FT   CDS_pept        721931..722305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0581"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cno:NT01CX_0788 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50352"
FT                   /db_xref="GOA:D9SR64"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR64"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADL50352.1"
FT                   /translation="MSYYFDDKIPIYLQIMDIIKQNIVSGELSEGDKLLSVREMAEKYS
FT                   VNPNTIQRAYQELERNNIIYTQRGMGTFITKDSSKIEEIKNTMAVDIVITFIDGMKKIG
FT                   FASEEAIKVLQNYVAKEMKG"
     atgagttatt attttgatga taaaatccca atatacctgc agataatgga tatcataaaa        60
     caaaacattg taagtggaga attatcagaa ggtgataagc tgttgtctgt aagagaaatg       120
     gctgagaaat atagcgtaaa tccaaataca attcaaagag cttatcaaga gctagaaaga       180
     aacaatatca tttacactca gagaggaatg ggaacattta taacgaagga tagcagcaaa       240
     attgaagaaa ttaaaaacac aatggctgta gatattgtta taacttttat agatggaatg       300
     aaaaaaattg ggtttgcttc agaggaggct attaaggttc ttcaaaacta tgttgcaaag       360
     gagatgaaag ggtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page