(data stored in ACNUC7421 zone)

EMBL: CP002160.PE564

CP002160.PE564       Location/Qualifiers
FT   CDS_pept        723835..724512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0584"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cac:CAC3560 ABC-type transporter, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50355"
FT                   /db_xref="GOA:D9SR67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50355.1"
FT                   /translation="MSYVIEVEDLHKSYQMGDMSVDILKGISLNISLGEFVSIMGPSGS
FT                   GKSTLLYLLGGLDKPTKGSIKIKGSDIAKMNDKAESIMRRREIGFVFQFYNLIPNLTVE
FT                   ENIMLPLLLDGKKTNKYKKELNDILEIVGLTERRNHTPRELSGGQQQRVAIARALINEP
FT                   DIILADEPIGNLDSKTGNEIMNLFQKINKEKGKTIVQVTHSIESAGFGQRIINVRDGKV
FT                   ENI"
     gtgagttacg taattgaagt agaagattta cataagagct atcaaatggg ggatatgtct        60
     gttgatattc ttaaaggtat aagcttgaat atctctttag gagaatttgt ttcaataatg       120
     ggaccttcag gttctggaaa aagtacattg ctttatcttt taggaggtct agataaacca       180
     acaaaaggaa gcataaaaat aaaaggttct gatattgcaa aaatgaatga taaagctgag       240
     agtataatga gaagaagaga aattggtttt gtgtttcagt tttataatct aatacctaac       300
     ttaactgttg aagaaaacat aatgcttcct cttttgctag atggcaaaaa gacaaataag       360
     tataaaaaag agctcaatga tattcttgaa atagtaggac ttacagaaag aagaaaccat       420
     acaccaagag aactatctgg tggacagcag caaagagttg caattgcaag ggcattaatt       480
     aatgagccag atattatatt agctgacgaa cctatcggaa atcttgattc caaaactgga       540
     aatgagataa tgaatctttt ccaaaaaata aataaggaaa agggaaaaac tattgtccaa       600
     gttacgcact ctatagaatc tgctggcttt ggtcaaagaa taataaatgt tagagatgga       660
     aaggtggaaa atatctaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page