(data stored in ACNUC7421 zone)

EMBL: CP002160.PE566

CP002160.PE566       Location/Qualifiers
FT   CDS_pept        725723..728212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0586"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   amt:Amet_3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50357"
FT                   /db_xref="GOA:D9SR69"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR69"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50357.1"
FT                   /translation="MSIVLKMLIKNITSKKARTFLILFSIILSTAVFFSSIAISGSILK
FT                   TVLGSVTQVVGVSDITISPTEKSDSKFLSQSALEKYKNDFDIVVGELDASGVYNVTLGE
FT                   SVPVIVKGVVPEELNKVNPFSIASSLENEEFKGKSIIVSSTVAEDHNLKLGDTITVVIK
FT                   GQEQRFTLWGIASAKGPFSKAITVPNFAIPEETMASLLDAHGKKNILYIKLKDTSLKKS
FT                   MVKTLQSDYKSYQVKETFNVEKLQSNLSDISSIFLLLSGIVFFMSAFIIYSSFKVIAAE
FT                   RIPVIGTLRSIGATKKTTNTILLGESILYGTIGGFLGCGFGIGLLYVLSLYMSDIANVT
FT                   PGLQLNTTIQFSFAQLAVAFIISILLSFISSIFPIMKISKIPIKDVILRTAELVKKDKK
FT                   IKILLPIICVVIAYLITIPKYNPDDNLFLGLAMLFALLAIVFFIPYATKLFVKLFEKIY
FT                   VVIFGNIGILAAKNLRENKGVLNNMIMLAISISVLLAINTTGYNTVLSSLNSYKGANFD
FT                   LKITVSNAENSFVNKLYNKDGVEDVYVDYEFENIKIVDTDTAIGTVKGIDMLKFSDFWT
FT                   ISTEEDFGDMSKELDAGRNIMISSTLQRTLEVQKGDVLKLKTTSGEKEYKIIGFFKDFM
FT                   NDSDYALVSERFMKADMKSSEASAYYVRSSIAPKELGKELKADFKKLSPKINTKAQLEQ
FT                   IEVDDNVNTISLMQSFCIMAIVIGFFGVINNLVLSFMQRKQSLAMFRSVGMSKKQIVSM
FT                   TFIEAFTGAVIGGIMGVVGGIGMTYILSKLDDSKLVIQIEYLGLYVAIGILVMILASII
FT                   PVVKSAKLNLIEAVKQE"
     atgagtattg ttttaaaaat gctaataaaa aatattacta gtaagaaagc caggaccttc        60
     ttaatacttt tttcaataat tttatctaca gcagtattct tctcctccat tgctatttct       120
     ggaagtatat taaaaactgt attgggatca gtaacacagg ttgttggtgt ttctgatatt       180
     acaatctctc ctacagagaa atcagatagt aaatttctta gtcaaagtgc actagagaaa       240
     tataaaaatg attttgacat agttgttggg gaattagatg ctagtggggt ttacaatgta       300
     acccttggag aaagcgtacc tgtaatagta aaaggtgtag ttccagagga attaaataaa       360
     gttaaccctt ttagtatagc tagttctcta gaaaatgaag agtttaaggg caaaagcata       420
     atagtaagta gtactgtagc tgaagatcat aaccttaagc ttggagatac tataacggtt       480
     gttataaagg gacaagagca gagatttacc ctatggggta tagcttcagc taaaggacca       540
     tttagtaaag cgataactgt tcccaatttt gcaataccag aggaaacaat ggcatctttg       600
     ttggatgctc atggtaaaaa gaatatactt tacataaaac ttaaagatac aagtttgaaa       660
     aagtctatgg tgaagacttt acaatcagat tataaatcat atcaagtaaa agagacattt       720
     aatgtagaaa aactgcaaag taatctttct gatatttcat ctatattctt attactatca       780
     ggaatagttt tctttatgag tgcttttata atttattcat cctttaaggt aatagcagca       840
     gaacgaattc ctgtaatagg aaccttgagg agtataggag ctacaaagaa aactaccaat       900
     acaatattgt taggtgaaag tattttatat ggtacaatag gagggtttct tggctgtggt       960
     tttggaatag gtcttttata tgttctatca ttatatatga gtgatatagc taatgtaaca      1020
     ccaggattgc agctaaatac tacaatacag ttttcttttg cgcaacttgc ggtagccttt      1080
     ataatatcta tattattaag ctttattagt tctatcttcc ctattatgaa gatttctaaa      1140
     attcctatta aggatgtaat attaagaact gcagagttag ttaaaaagga taaaaaaata      1200
     aaaatactgc taccaataat atgtgtagta attgcttatt taattactat acctaagtat      1260
     aatccagatg ataacttatt cctagggtta gcaatgttgt ttgcgttgct tgcaatagta      1320
     ttctttatac cttatgcaac taagttattc gttaagttat tcgaaaaaat atatgttgtt      1380
     atttttggga acatcggaat attggctgca aagaatttaa gggagaataa gggtgtatta      1440
     aataacatga taatgcttgc cataagtatt tcagttttat tagccataaa tacaactggt      1500
     tacaacacag tattatcaag tttaaatagc tataaagggg caaactttga tttaaagata      1560
     acagtttcaa atgcggagaa ctcttttgtg aataagcttt ataacaaaga tggagttgaa      1620
     gacgtatatg tggattatga atttgaaaat ataaaaatag tagatactga cacagcaatt      1680
     ggaactgtaa agggaataga tatgttaaag ttctcagatt tctggaccat aagcactgaa      1740
     gaagattttg gtgatatgtc taaagaactt gatgcaggaa gaaatatcat gatttcttca      1800
     accttgcaaa gaactttaga ggttcagaag ggtgacgtac ttaagttaaa aacaactagt      1860
     ggtgaaaaag aatataaaat tattggattc ttcaaagatt ttatgaatga tagcgattat      1920
     gccttagttt ctgaaagatt tatgaaggct gatatgaaat ctagtgaggc ctcagcttat      1980
     tatgttaggt ctagtatagc acctaaggag ttgggaaaag aacttaaagc tgattttaag      2040
     aagcttagtc ctaaaattaa tacaaaggct caattagaac aaatagaagt tgatgataat      2100
     gtaaacacta tatctctaat gcagagcttc tgtataatgg ctatagtaat aggtttcttt      2160
     ggtgtaatta ataacttagt gcttagtttt atgcaaagaa aacagtctct tgcaatgttt      2220
     agatctgttg gtatgagcaa aaaacaaata gtatctatga ccttcattga agctttcaca      2280
     ggagctgtta ttggaggaat tatgggagta gttggtggta taggaatgac ttatatccta      2340
     tcaaaactag atgattcaaa gctagtaatc caaattgaat atttaggatt atatgtagca      2400
     attggtattt tagttatgat actagcatca attattccag tagttaagtc tgctaagctt      2460
     aatttaattg aggctgtaaa acaagagtag                                       2490
//

If you have problems or comments...

PBIL Back to PBIL home page