(data stored in ACNUC7421 zone)

EMBL: CP002160.PE567

CP002160.PE567       Location/Qualifiers
FT   CDS_pept        complement(728492..729733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0587"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   ckr:CKR_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50358"
FT                   /db_xref="GOA:D9SR70"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR70"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50358.1"
FT                   /translation="MNYKRKANMALGISVIFFCLCVVLRYFYRDAVIFKLLLFVAEASL
FT                   VGGIADWFAVTALFTKPLGFTYHTEIIPRNRKSIINSTANLVETDLLSKQTLKKHIDNL
FT                   AIVELLVKYFDEDKERKTNYIDKLSQFIMKYICKKDLKVAASYIENLLRKEGKNVSLSN
FT                   KLKDFIEDKFIYENRIVWVQDLLNKLSKGELDELILTISRKILANSEEKSSFSLKNLLK
FT                   KLNVSMAEDLANLIKSQLKIILTELMKEESGLPQECVENIIRSLDGIELSPASIEQWKL
FT                   NLLESTDFKPIIEAQLPLAINEISINTIVEKLWDYFKENSTIKSAIDRGIKELICDLLE
FT                   ENHNVIGSIVSDTLNNFTDEKLNAFVEDKAGEDLQWIRINGSVLGGCIGLVLFGFLNLI
FT                   FEPYVSPIIRGLLS"
     atgaattata aacgtaaagc taatatggca ctaggtattt cagtaatttt cttttgtctc        60
     tgtgtagtat taagatattt ttatagagac gctgttatat ttaaactatt gttatttgta       120
     gcagaagcct ctttagtagg aggtatagcc gattggtttg cagttactgc actttttaca       180
     aagccactag gttttactta ccacactgag ataataccaa gaaacagaaa gtccattata       240
     aattcaacag caaatctagt tgaaacagat ttattaagta agcaaacact gaaaaagcat       300
     atagataact tagcgatagt tgaactactt gttaaatatt ttgatgaaga taaagagaga       360
     aaaacaaatt atatagacaa gctttcacaa ttcattatga agtatatctg taaaaaagat       420
     ttgaaagtag cagctagtta tatagaaaat cttctaagaa aagaaggaaa gaacgtaagc       480
     ttatcaaata agctcaagga ttttatagaa gataaattta tatatgaaaa cagaatagta       540
     tgggtacaag atcttttaaa taagctctca aaaggggaat tagacgaact aatactcact       600
     atttcccgaa aaattcttgc taacagcgag gaaaaatcaa gcttttcact aaagaactta       660
     ctaaagaaat taaatgtatc aatggcagaa gatttagcaa acttaataaa atcacaactt       720
     aaaattatcc ttacagaact tatgaaggaa gaaagtggac ttccacagga atgtgtagaa       780
     aatataatta gaagtctaga tgggatagag ctttcgccag cttcaataga gcaatggaag       840
     cttaatctat tagaaagtac agattttaaa cctattatag aagcacaact tccattagct       900
     ataaatgaga tatctataaa tacgattgtg gagaaattat gggattactt taaagaaaat       960
     agcactatta aaagcgctat agatagaggc attaaagaac ttatatgtga tcttttagag      1020
     gaaaatcaca atgtaatagg cagtattgta agtgatacct taaacaactt tacagatgaa      1080
     aagttaaacg cctttgtaga ggataaagct ggtgaagact tacaatggat tagaataaat      1140
     ggttctgtcc ttggagggtg cataggctta gtattattcg gttttctaaa tttaattttt      1200
     gagccttacg tttctccaat aattagagga ttattatcct ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page