(data stored in ACNUC7421 zone)

EMBL: CP002160.PE57

CP002160.PE57        Location/Qualifiers
FT   CDS_pept        96188..97456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0059"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="KEGG: cbk:CLL_A3441 putative ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49848"
FT                   /db_xref="GOA:D9SMR3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR3"
FT                   /inference="similar to AA sequence:KEGG:CLL_A3441"
FT                   /protein_id="ADL49848.1"
FT                   /translation="MLALIKNEYRKLFRRTQTWVLIGLFLAVMCLGTVFAYYTYRIDQR
FT                   NQKPETQKANIEQQISYLEENKKQFANNESKDNQVKEEYESNIDREIANLRNQIDYLNQ
FT                   VIEKGEENIDWKSNLKTEIDNQKKTIEEMEKNAETNEGTENFVYLNNDLNQQKADLEKL
FT                   QYLYDNDIKPIKGSTFDGYSVINKIFTVLGGIILTLGVIIFSSDIVSGEMNPATVKFLL
FT                   VQPTTRRKILLSKFITIVTAAIGLIVGIQILFFLGIGITNGFGNGNYPVIVGAKFEVLK
FT                   TILLSDGSHPIAIIENSMHIISTSQYFIQYIGFEILFILAGSAFGFMLSTICKSATLST
FT                   VIGIIISIASPIFFQVVKGLKKFVHLLFVAYNDPSMILSGMSAQYYNNIHYNGITGIIV
FT                   LIVTAVICYIVSDIIFTRKDFAA"
     atgctagcac ttattaaaaa tgagtataga aagttattta gaagaacaca gacatgggtg        60
     cttataggat tattcttagc tgtaatgtgt ttaggcactg tatttgcata ctatacttat       120
     cgtatagatc aaagaaatca aaaaccagaa actcaaaagg ctaatataga acaacaaata       180
     agctatttag aagagaataa aaaacaattt gcaaataacg aatcaaaaga taatcaagtt       240
     aaagaggaat atgagtcaaa tattgatagg gaaattgcaa atttaagaaa tcaaattgat       300
     tacctaaatc aagttataga aaaaggcgaa gagaatatag attggaagtc taacttaaaa       360
     acagaaatag ataatcaaaa gaaaaccata gaagaaatgg agaagaatgc ggaaacaaat       420
     gaaggtacag aaaattttgt ttatttaaat aacgatctaa atcaacagaa agcagactta       480
     gaaaaacttc aatacctata tgataatgat ataaagccaa ttaaaggaag cactttcgat       540
     ggttattcag taataaataa aatatttacg gttttaggtg ggataatttt aactttagga       600
     gtaattatat tctcaagtga tatagtatca ggagaaatga acccagcaac tgttaagttc       660
     ttattggtac aaccaactac aagaaggaaa atattattat cgaaatttat aacaatagtt       720
     acagcagcaa taggattaat agtaggaatc cagattctct tcttcttagg tattggaatt       780
     actaatgggt ttgggaatgg gaattatcca gtaatagtcg gagctaagtt cgaagtatta       840
     aagacaatac tattatcaga tggttcacat ccaattgcta ttatagaaaa ctcaatgcat       900
     attataagta ctagtcaata ttttatacaa tacataggct tcgagatact atttatttta       960
     gctggatctg cttttgggtt tatgttatct actatatgca agagtgcaac tttatctacg      1020
     gtaattggta ttataatatc aatagcttcc ccaattttct tccaagttgt taaaggacta      1080
     aaaaagtttg ttcatttact atttgtagca tataatgatc catcaatgat actaagtgga      1140
     atgtcagcac agtattataa taatattcat tataatggta tcactgggat cattgtatta      1200
     atagtaactg cagtaatatg ttatatcgta tcagatataa tttttacaag aaaagatttt      1260
     gcagcttaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page