(data stored in ACNUC7421 zone)

EMBL: CP002160.PE571

CP002160.PE571       Location/Qualifiers
FT   CDS_pept        735255..735902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0591"
FT                   /product="transaldolase"
FT                   /note="KEGG: cac:CAC1347 putative translaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50362"
FT                   /db_xref="GOA:D9SR74"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR74"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ADL50362.1"
FT                   /translation="MKIFIDTANVDEIIEANDMGVICGVTTNPSLVAKEGKDFNEVIKT
FT                   IASIVDGPISGEVNSDDAEGMIVEGREIAKIHKNMVVKIPMTKEGLKAVKVLTAEGIKT
FT                   NVTLVFSAAQALLAANAGATYVSPFVGRLDDIGSTGMELIEKIAYIFERQDIETEIIAA
FT                   SIRSSIHAIEAAEAGAHIATIPYGVLMNMAKHPLTDSGIERFKKDWADAFNK"
     atgaaaatat ttatagatac agctaatgtt gatgaaatta tcgaagctaa cgacatggga        60
     gttatttgtg gtgtaactac aaacccttca ttagtagcaa aagaaggaaa agactttaat       120
     gaagttataa aaactatagc atcaatcgtt gatggtccta taagtggaga agttaacagt       180
     gatgatgcag aaggtatgat tgttgaagga agagaaatag ctaaaatcca caaaaacatg       240
     gttgttaaaa ttccaatgac taaagaaggt ttaaaagcag ttaaagtttt aacagctgaa       300
     ggaattaaaa ctaatgttac tttagtattt agtgctgctc aagcattgct tgctgcaaac       360
     gcaggagcaa cttatgtaag tcctttcgtt ggtagattag acgatatcgg aagcactggt       420
     atggagctta tagaaaaaat tgcttacata tttgaaagac aagatataga aacagaaatt       480
     attgcagcta gcataagaag ttcaattcac gcaattgaag cagcagaagc tggagcacac       540
     attgctacaa ttccttatgg agtgttaatg aacatggcta aacacccatt aacagattca       600
     ggtatcgaaa gatttaaaaa agattgggca gatgctttta ataaataa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page