(data stored in ACNUC7421 zone)

EMBL: CP002160.PE64

CP002160.PE64        Location/Qualifiers
FT   CDS_pept        110269..110907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49855"
FT                   /db_xref="GOA:D9SMS0"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMS0"
FT                   /inference="similar to AA sequence:KEGG:Strop_3431"
FT                   /protein_id="ADL49855.1"
FT                   /translation="MKSENRRIVVLITTTIIILVSLYLNIELKDKYMQDQELQCFSYES
FT                   QQKNYYCGPATAVMILRYEGIDMEQEEVAIDLETENYEGTPWYDDSYPMKDTLNKYLKE
FT                   DVYQELSGKCDSNVIVDSIVKTLDKGYLVAVNIVETSLTAHLEGHPRDQDIYHWIVICD
FT                   YEDNGKNFKYMDPAASSVVSWHRGVPKIGTVTSEDLCSMVIDRGVIVSP"
     atgaaaagtg aaaataggag aatagtagta ttaataacaa caacgataat aattttagtt        60
     tctttgtact tgaatattga actaaaggat aaatatatgc aagatcaaga attacagtgt       120
     ttttcttatg agagtcaaca aaaaaactat tattgtgggc cagctacagc agtaatgata       180
     ttaaggtacg aaggaattga tatggaacag gaggaggttg ccattgattt agaaactgaa       240
     aattatgaag gaacgccatg gtatgatgac tcgtacccaa tgaaggatac tttaaataag       300
     tatttgaaag aagatgtgta tcaagagctt agtggcaaat gtgattctaa tgtaatagtt       360
     gatagtattg ttaaaacttt agataaagga tatttagttg cagttaacat tgttgagact       420
     agcttaacag ctcatctaga aggtcatcca agggatcagg acatatacca ttggatagtt       480
     atttgtgatt atgaggacaa tgggaaaaac ttcaaatata tggatccagc tgcatcatct       540
     gttgtatctt ggcatagagg tgttccgaaa ataggtactg tgactagtga agatttatgt       600
     tctatggtta tagatagagg agtgatagta agtccttag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page